You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SLC2A1
Solute carrier family 2, facilitated glucose transporter member 1

Protein Summary
Description
Facilitative glucose transporter. This isoform may be responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. This gene encodes a major glucose transporter in the mammalian blood-brain barrier. The encoded protein is found primarily in the cell membrane and on the cell surface, where it can also function as a receptor for human T-cell leukemia virus (HTLV) I and II. Mutations in this gene have been found in a family with paroxysmal exertion-induced dyskinesia. [provided by RefSeq, Apr 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000426263
  • ENSP00000416293
  • ENSG00000117394

Symbol
  • GLUT1
  • CSE
  • PED
  • DYT9
  • GLUT
  • DYT17
  • DYT18
  • EIG12
  • GLUT1
  • HTLVR
  • GLUT-1
  • SDCHCN
  • GLUT1DS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
cellular component
0.98
transcription factor perturbation
0.97
chemical
0.96
interacting protein
0.96


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2871.11   (req: < 5)
Gene RIFs: 461   (req: <= 3)
Antibodies: 625   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2871.11   (req: >= 5)
Gene RIFs: 461   (req: > 3)
Antibodies: 625   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 49
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (49)
1 – 10 of 49
CHEMBL3780717
chemical structure image
CHEMBL3780372
chemical structure image
CHEMBL3780470
chemical structure image
CHEMBL3781913
chemical structure image
CHEMBL3781331
chemical structure image
CHEMBL3781835
chemical structure image
CHEMBL3781347
chemical structure image
CHEMBL3781149
chemical structure image
CHEMBL3780772
chemical structure image
CHEMBL3780235
chemical structure image
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (99)
Cellular hexose transport (R-HSA-189200)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular hexose transport
Reactome
Defective SLC2A1 causes GLUT1 deficiency syndrome 1 (GLUT1DS1)
Reactome
Disease
Reactome
Disorders of transmembrane transporters
Reactome
Integration of energy metabolism
Name
Explore in Pharos
Explore in Source
Cellular hexose transport
Defective SLC2A1 causes GLUT1 deficiency syndrome 1 (GLUT1DS1)
Disease
Disorders of transmembrane transporters
Integration of energy metabolism
Gene Ontology Terms (38)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (239)
1 – 10 of 239
ATP6V0A2
Tbio
Family: Enzyme
Novelty: 0.0033925
p_int: 0.987387378
p_ni: 0.012612622
Data Source: BioPlex
ATP6V0A1
Tbio
Family: Enzyme
Novelty: 0.03404906
p_int: 0.959211177
p_ni: 0.040788823
Data Source: BioPlex
ATP11C
Tbio
Family: Transporter
Novelty: 0.06715014
p_int: 0.938923536
p_ni: 0.061076436
p_wrong: 2.8e-8
Data Source: BioPlex
ATP6V0C
Tbio
Family: Enzyme
Novelty: 0.01276499
p_int: 0.891584561
p_ni: 0.108415347
p_wrong: 9.2e-8
Data Source: BioPlex
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.95
Data Source: STRINGDB
GIPC1
Tbio
Novelty: 0.00821824
Score: 0.893
Data Source: STRINGDB
INS
Tbio
Novelty: 0.00000614
Score: 0.873
Data Source: STRINGDB
AKT1
Tchem
Family: Kinase
Novelty: 0.0000383
Score: 0.872
Data Source: STRINGDB
HK2
Tchem
Family: Kinase
Novelty: 0.00222818
Score: 0.867
Data Source: STRINGDB
HIF1A
Tchem
Family: TF
Novelty: 0.00031917
Score: 0.852
Data Source: STRINGDB
Publication Statistics
PubMed Score  2871.11

PubMed score by year
PubTator Score  2152.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVA
1-70
IFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFV
70-140
PMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPES
140-210
PRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL
210-280
SQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAIL
280-350
MTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
350-420
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADS
420-490
QV
490-492
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV