You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SERPINA1
Alpha-1-antitrypsin

Protein Summary
Description
Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin. Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE). The protein encoded by this gene is secreted and is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema or liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000355814
  • ENSP00000348068
  • ENSG00000197249
  • ENST00000393087
  • ENSP00000376802
  • ENST00000393088
  • ENSP00000376803
  • ENST00000402629
  • ENSP00000386094
  • ENST00000404814
  • ENSP00000385960
  • ENST00000437397
  • ENSP00000408474
  • ENST00000440909
  • ENSP00000390299
  • ENST00000448921
  • ENSP00000416066
  • ENST00000449399
  • ENSP00000416354
  • ENST00000489769
  • ENSP00000451525
  • ENST00000636712
  • ENSP00000490054

Symbol
  • AAT
  • PI
  • PI
  • A1A
  • AAT
  • PI1
  • A1AT
  • nNIF
  • PRO2275
  • alpha1AT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.95
kinase perturbation
0.88
cellular component
0.86
small molecule perturbation
0.83
gene perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5818.01   (req: < 5)
Gene RIFs: 363   (req: <= 3)
Antibodies: 1506   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5818.01   (req: >= 5)
Gene RIFs: 363   (req: > 3)
Antibodies: 1506   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (28)
1 – 5 of 28
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (49)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 18
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
COPII-mediated vesicle transport
Reactome
Cargo concentration in the ER
Reactome
ER to Golgi Anterograde Transport
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
COPII-mediated vesicle transport
Cargo concentration in the ER
ER to Golgi Anterograde Transport
Hemostasis
Protein-Protein Interactions (387)
1 – 10 of 387
DDX31
Tbio
Family: Enzyme
Novelty: 4
p_int: 0.999995172
p_ni: 0.000004828
Data Source: BioPlex
MAPK6
Tbio
Family: Kinase
Novelty: 0.01585877
p_int: 0.999992378
p_ni: 0.000007622
Data Source: BioPlex
SNX27
Tbio
Novelty: 0.02796021
p_int: 0.999822112
p_ni: 0.000177888
Data Source: BioPlex
CA8
Tbio
Family: Enzyme
Novelty: 0.00285108
p_int: 0.999795787
p_ni: 0.000204213
Score: 0.151
Data Source: BioPlex,STRINGDB
DDX19B
Tbio
Family: Enzyme
Novelty: 0.05099873
p_int: 0.999697321
p_ni: 0.000302675
p_wrong: 4e-9
Data Source: BioPlex
ICE2
Tbio
Novelty: 0.05712472
p_int: 0.999387966
p_ni: 0.000612023
p_wrong: 1.1e-8
Score: 0.186
Data Source: BioPlex,STRINGDB
GDPD1
Tbio
Family: Enzyme
Novelty: 0.1910828
p_int: 0.998343119
p_ni: 0.001656881
Data Source: BioPlex
GOT1L1
Tdark
Family: Enzyme
Novelty: 0.66666667
p_int: 0.996449865
p_ni: 0.003527778
p_wrong: 0.000022357
Score: 0.207
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.99187369
p_ni: 0.008126248
p_wrong: 6.2e-8
Score: 0.214
Data Source: BioPlex,STRINGDB
ALDH2
Tclin
Family: Enzyme
Novelty: 0.00094367
p_int: 0.991679777
p_ni: 0.008320109
p_wrong: 1.14e-7
Score: 0.273
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  5818.01

PubMed score by year
PubTator Score  6647.99

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN
1-70
STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN
70-140
GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN
140-210
YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD
210-280
EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP
280-350
LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
350-418
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK