You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KCNIP1
Kv channel-interacting protein 1

Protein Summary
Description
Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Regulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Increases the presence of KCND2 at the cell surface. This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subunits to form native Kv4 channel complexes. The encoded protein may regulate rapidly inactivating (A-type) currents, and hence neuronal membrane excitability, in response to changes in the concentration of intracellular calcium. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000377360
  • ENSP00000366577
  • ENSG00000182132
  • ENST00000411494
  • ENSP00000395323
  • ENST00000434108
  • ENSP00000414886
  • ENST00000520740
  • ENSP00000431102

Symbol
  • KCHIP1
  • VABP
  • VABP
  • KCHIP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
transcription factor
0.66
phenotype
0.62
tissue sample
0.6
cell line
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.04   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 281   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.04   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 281   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Cardiac conduction (R-HSA-5576891)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cardiac conduction
Reactome
Muscle contraction
Reactome
Phase 1 - inactivation of fast Na+ channels
Name
Explore in Pharos
Explore in Source
Cardiac conduction
Muscle contraction
Phase 1 - inactivation of fast Na+ channels
Protein-Protein Interactions (79)
1 – 10 of 79
KCNIP2
Tbio
Family: IC
Novelty: 0.0124069
p_int: 0.999999581
p_ni: 4e-9
p_wrong: 4.15e-7
Score: 0.876
Data Source: BioPlex,Reactome,STRINGDB
KCNIP4
Tbio
Family: IC
Novelty: 0.01754679
p_int: 0.999990666
p_wrong: 0.000009334
Score: 0.879
Data Source: BioPlex,Reactome,STRINGDB
TBC1D28
Tdark
p_int: 0.999583251
p_ni: 0.000415138
p_wrong: 0.000001611
Data Source: BioPlex
KCND3
Tclin
Family: IC
Novelty: 0.00426758
Score: 0.998
Data Source: Reactome,STRINGDB
KCND2
Tclin
Family: IC
Novelty: 0.00380702
Score: 0.997
Data Source: Reactome,STRINGDB
KCND1
Tclin
Family: IC
Novelty: 0.05993226
Score: 0.995
Data Source: Reactome,STRINGDB
KCNC1
Tclin
Family: IC
Novelty: 0.00326413
Score: 0.901
Data Source: STRINGDB
KCNA4
Tclin
Family: IC
Novelty: 0.00458772
Score: 0.778
Data Source: STRINGDB
DPP6
Tbio
Family: Enzyme
Novelty: 0.00786368
Score: 0.737
Data Source: STRINGDB
UHMK1
Tbio
Family: Kinase
Novelty: 0.00180095
Score: 0.703
Data Source: STRINGDB
Publication Statistics
PubMed Score  38.04

PubMed score by year
PubTator Score  31.17

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRG
1-70
FKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRW
70-140
TFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESC
140-210
QEDDNIMRSLQLFQNVM
210-227
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM