You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ABHD4
Protein ABHD4

Protein Summary
Description
Lysophospholipase selective for N-acyl phosphatidylethanolamine (NAPE). Contributes to the biosynthesis of N-acyl ethanolamines, including the endocannabinoid anandamide by hydrolyzing the sn-1 and sn-2 acyl chains from N-acyl phosphatidylethanolamine (NAPE) generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate for N-acyl ethanolamine biosynthesis. Hydrolyzes substrates bearing saturated, monounsaturated, polyunsaturated N-acyl chains. Shows no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine and lysophosphatidylserine (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000418446
  • ENSP00000388751
  • ENSG00000100439
  • ENST00000428304
  • ENSP00000414558

Symbol
  • ABH4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.97
small molecule perturbation
0.85
disease
0.84
disease perturbation
0.83
metabolite
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.62   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 212   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.62   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 212   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Acyl chain remodelling of PE (R-HSA-1482839)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acyl chain remodelling of PE
Reactome
Glycerophospholipid biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Phospholipid metabolism
Name
Explore in Pharos
Explore in Source
Acyl chain remodelling of PE
Glycerophospholipid biosynthesis
Metabolism
Metabolism of lipids
Phospholipid metabolism
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (51)
1 – 10 of 51
GDE1
Tbio
Family: Enzyme
Novelty: 0.11583012
Score: 0.839
Data Source: STRINGDB
NAPEPLD
Tbio
Family: Enzyme
Novelty: 0.01113091
Score: 0.82
Data Source: STRINGDB
FAAH2
Tchem
Family: Enzyme
Novelty: 0.14778758
Score: 0.743
Data Source: STRINGDB
PTPN22
Tchem
Family: Enzyme
Novelty: 0.0018748
Score: 0.716
Data Source: STRINGDB
ABHD12
Tchem
Family: Enzyme
Novelty: 0.0397
Score: 0.708
Data Source: STRINGDB
FAAH
Tchem
Family: Enzyme
Novelty: 0.00204327
Score: 0.702
Data Source: STRINGDB
ABHD6
Tchem
Family: Enzyme
Novelty: 0.02917188
Score: 0.691
Data Source: STRINGDB
METTL3
Tbio
Family: Enzyme
Novelty: 0.01066956
Score: 0.668
Data Source: STRINGDB
MGLL
Tchem
Family: Enzyme
Novelty: 0.00291863
Score: 0.657
Data Source: STRINGDB
TOX4
Tbio
Family: TF
Novelty: 0.03661513
Score: 0.618
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.62

PubMed score by year
PubTator Score  2.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTP
1-70
LVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSM
70-140
ILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVA
140-210
GPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKD
210-280
VPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD
280-342
MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD