You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BDNF
Brain-derived neurotrophic factor

Protein Summary
Description
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene i ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000314915
  • ENSP00000320002
  • ENSG00000176697
  • ENST00000356660
  • ENSP00000349084
  • ENST00000395978
  • ENSP00000379302
  • ENST00000395980
  • ENSP00000379304
  • ENST00000395981
  • ENSP00000379305
  • ENST00000395983
  • ENSP00000379307
  • ENST00000395986
  • ENSP00000379309
  • ENST00000418212
  • ENSP00000400502
  • ENST00000420794
  • ENSP00000389564
  • ENST00000438929
  • ENSP00000414303
  • ENST00000439476
  • ENSP00000389345
  • ENST00000525528
  • ENSP00000437138
  • ENST00000525950
  • ENSP00000432035
  • ENST00000530861
  • ENSP00000435564
  • ENST00000532997
  • ENSP00000435805
  • ENST00000533131
  • ENSP00000432727
  • ENST00000533246
  • ENSP00000432376

Symbol
  • ANON2
  • BULN2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
1
PubMedID
0.98
cellular component
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12162.61   (req: < 5)
Gene RIFs: 1703   (req: <= 3)
Antibodies: 1079   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12162.61   (req: >= 5)
Gene RIFs: 1703   (req: > 3)
Antibodies: 1079   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (55)
Activated NTRK2 signals through CDK5 (R-HSA-9032845)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 21
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activated NTRK2 signals through CDK5
Reactome
Activated NTRK2 signals through FRS2 and FRS3
Reactome
Activated NTRK2 signals through FYN
Reactome
Activated NTRK2 signals through PI3K
Reactome
Activated NTRK2 signals through PLCG1
Name
Explore in Pharos
Explore in Source
Activated NTRK2 signals through CDK5
Activated NTRK2 signals through FRS2 and FRS3
Activated NTRK2 signals through FYN
Activated NTRK2 signals through PI3K
Activated NTRK2 signals through PLCG1
Gene Ontology Terms (34)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (626)
1 – 10 of 626
NTRK2
Tclin
Family: Kinase
Novelty: 0.00060827
Score: 0.998
Data Source: Reactome,STRINGDB
NGFR
Tclin
Novelty: 0.00089072
Score: 0.996
Data Source: STRINGDB
NTF4
Tbio
Novelty: 0.00132431
Score: 0.993
Data Source: STRINGDB
NTRK1
Tclin
Family: Kinase
Novelty: 0.0004431
Score: 0.991
Data Source: STRINGDB
GRIN2B
Tclin
Family: IC
Novelty: 0.00042857
Score: 0.982
Data Source: Reactome,STRINGDB
SORT1
Tchem
Novelty: 0.00361051
Score: 0.979
Data Source: STRINGDB
CDK5
Tchem
Family: Kinase
Novelty: 0.00081843
Score: 0.977
Data Source: Reactome,STRINGDB
NTF3
Tbio
Novelty: 0.00076486
Score: 0.975
Data Source: STRINGDB
MAPK8
Tchem
Family: Kinase
Novelty: 0.00013952
Score: 0.973
Data Source: STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.967
Data Source: STRINGDB
Publication Statistics
PubMed Score  12162.61

PubMed score by year
PubTator Score  6177.62

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEEL
1-70
LDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSV
70-140
CDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRT
140-210
TQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
210-247
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR