You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PGAM4
Probable phosphoglycerate mutase 4

Protein Summary
Description
This intronless gene appears to have arisen from a retrotransposition event, yet it is thought to be an expressed, protein-coding gene. The encoded protein is a member of the phosphoglycerate mutase family, a set of enzymes that catalyze the transfer of a phosphate group from 3-phosphoglycerate to 2-phosphoglycerate. [provided by RefSeq, May 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000458128
  • ENSP00000412189
  • ENSG00000226784

Symbol
  • PGAM3
  • PGAM1
  • PGAM3
  • PGAM-B
  • dJ1000K24.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.68
protein domain
0.58
cellular component
0.53
microRNA
0.49
tissue sample
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.57   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 80   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.57   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 80   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Central carbon metabolism in cancer
KEGG
Glycolysis / Gluconeogenesis
KEGG
Carbon metabolism
KEGG
Glucagon signaling pathway
KEGG
Glycine, serine and threonine metabolism
Name
Explore in Pharos
Explore in Source
Central carbon metabolism in cancer
Glycolysis / Gluconeogenesis
Carbon metabolism
Glucagon signaling pathway
Glycine, serine and threonine metabolism
Protein-Protein Interactions (61)
1 – 10 of 61
PGAM2
Tbio
Family: Enzyme
Novelty: 0.02989704
p_int: 0.999999999
p_wrong: 1e-9
Score: 0.935
Data Source: BioPlex,STRINGDB
PGK1
Tchem
Family: Kinase
Novelty: 0.00144192
Score: 0.987
Data Source: STRINGDB
PGK2
Tbio
Family: Kinase
Novelty: 0.01008054
Score: 0.977
Data Source: STRINGDB
GPI
Tbio
Family: Enzyme
Novelty: 0.00073017
Score: 0.952
Data Source: STRINGDB
PHGDH
Tbio
Family: Enzyme
Novelty: 0.00062836
Score: 0.931
Data Source: STRINGDB
ENO1
Tchem
Family: Enzyme
Novelty: 0.00138287
Score: 0.929
Data Source: STRINGDB
TALDO1
Tbio
Family: Enzyme
Novelty: 0.00254889
Score: 0.917
Data Source: STRINGDB
TPI1
Tbio
Family: Enzyme
Novelty: 0.00117277
Score: 0.915
Data Source: STRINGDB
GLYCTK
Tbio
Family: Kinase
Novelty: 0.13559322
Score: 0.91
Data Source: STRINGDB
MINPP1
Tbio
Family: Enzyme
Novelty: 0.03074783
Score: 0.906
Data Source: STRINGDB
Publication Statistics
PubMed Score  14.57

PubMed score by year
PubTator Score  10.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQKRVIRTLWTV
1-70
LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR
70-140
RYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLQGIAKHVEGLSEEAIMELNL
140-210
PTGIPIVYELDKNLKPIKPMQFLGDEETVCKAIEAVAAQGKAKK
210-254
MAAYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQKRVIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLQGIAKHVEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVCKAIEAVAAQGKAKK