You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
GABRG2
Gamma-aminobutyric acid receptor subunit gamma-2

Protein Classes
Protein Summary
Description
Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand-gated chloride channel. This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene have been associated with epilepsy and febrile seizures. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000414552
  • ENSP00000410732
  • ENSG00000113327
  • ENST00000639111
  • ENSP00000492125
  • ENST00000639213
  • ENSP00000491909

Symbol
  • CAE2
  • ECA2
  • GEFSP3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
1
molecular function
0.93
protein domain
0.92
chemical
0.91
gene perturbation
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 87.5   (req: < 5)
Gene RIFs: 100   (req: <= 3)
Antibodies: 360   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 87.5   (req: >= 5)
Gene RIFs: 100   (req: > 3)
Antibodies: 360   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 48
Approved Drugs (48)
1 – 10 of 48
topiramate
chemical structure image
triazolam
chemical structure image
diazepam
chemical structure image
halothane
chemical structure image
flumazenil
chemical structure image
midazolam
chemical structure image
zopiclone
chemical structure image
isoflurane
chemical structure image
zolpidem
chemical structure image
desflurane
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
GABA receptor activation (R-HSA-977443)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
GABA receptor activation
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Reactome
Signal Transduction
Reactome
Signaling by ERBB4
Name
Explore in Pharos
Explore in Source
GABA receptor activation
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Signal Transduction
Signaling by ERBB4
Gene Ontology Terms (31)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (235)
1 – 10 of 235
GABRG1
Tclin
Family: IC
Novelty: 0.09162868
p_int: 0.999999999
p_wrong: 1e-9
Score: 0.845
Data Source: BioPlex,STRINGDB
TUBB1
Tclin
Novelty: 0.05351568
p_int: 0.998477408
p_ni: 0.001522592
Data Source: BioPlex
HLA-A
Tbio
Novelty: 0.00378961
p_int: 0.99542299
p_ni: 0.00457701
Data Source: BioPlex
DNAJC18
Tdark
p_int: 0.981796317
p_ni: 0.018203683
Score: 0.209
Data Source: BioPlex,STRINGDB
BSCL2
Tbio
Novelty: 0.00356699
p_int: 0.960329754
p_ni: 0.039670246
Score: 0.192
Data Source: BioPlex,STRINGDB
B4GALT5
Tbio
Family: Enzyme
Novelty: 0.0379107
p_int: 0.942194177
p_ni: 0.055648656
p_wrong: 0.002157167
Score: 0.179
Data Source: BioPlex,STRINGDB
CANX
Tbio
Novelty: 0.00135361
p_int: 0.940658917
p_ni: 0.059341083
Data Source: BioPlex
GPAA1
Tbio
Novelty: 0.0275169
p_int: 0.878915522
p_ni: 0.121084477
p_wrong: 1e-9
Score: 0.179
Data Source: BioPlex,STRINGDB
LCLAT1
Tbio
Family: Enzyme
Novelty: 0.0461716
p_int: 0.850142559
p_ni: 0.149841162
p_wrong: 0.000016279
Score: 0.183
Data Source: BioPlex,STRINGDB
ABHD14A
Tdark
Family: Enzyme
Novelty: 1.24515393
p_int: 0.818280218
p_ni: 0.181700267
p_wrong: 0.000019516
Score: 0.179
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  87.50

PubMed score by year
PubTator Score  114.83

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVIL
1-70
NNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSN
70-140
MVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSS
140-210
YGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTY
210-280
IPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSAL
280-350
VEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCC
350-420
FEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL
420-467
MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL