You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SFRP4
Secreted frizzled-related protein 4

Protein Summary
Description
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types (By similarity). SFRP4 plays a role in bone morphogenesis. May also act as a regulator of adult uterine morphology and function. May also increase apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity). Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake (PubMed:12952927). Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in ventricular myocardium correlates with apoptosis related gene expression. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000436072
  • ENSP00000410715
  • ENSG00000106483

Symbol
  • FRPHE
  • PYL
  • FRP-4
  • FRPHE
  • FRZB-2
  • sFRP-4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.96
protein domain
0.85
biological process
0.84
small molecule perturbation
0.76
biological term
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 394.72   (req: < 5)
Gene RIFs: 63   (req: <= 3)
Antibodies: 352   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 394.72   (req: >= 5)
Gene RIFs: 63   (req: > 3)
Antibodies: 352   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (24)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Protein-Protein Interactions (90)
1 – 10 of 90
PPP2R3A
Tbio
Family: Enzyme
Novelty: 0.05471953
p_int: 0.999987156
p_ni: 8.27e-7
p_wrong: 0.000012017
Score: 0.211
Data Source: BioPlex,STRINGDB
TUBB1
Tclin
Novelty: 0.05351568
p_int: 0.999408494
p_ni: 0.000591506
Data Source: BioPlex
SIRT1
Tchem
Family: Epigenetic
Novelty: 0.00025951
p_int: 0.998859276
p_ni: 0.001140724
Score: 0.2
Data Source: BioPlex,STRINGDB
DCAF16
Tdark
Novelty: 0.96774194
p_int: 0.99508622
p_ni: 0.0024704
p_wrong: 0.00244338
Score: 0.158
Data Source: BioPlex,STRINGDB
ANKHD1
Tbio
Novelty: 0.08323329
p_int: 0.99256608
p_ni: 0.007433919
Score: 0.197
Data Source: BioPlex,STRINGDB
CALR
Tbio
Novelty: 0.00058349
p_int: 0.986165662
p_ni: 0.013834338
Score: 0.228
Data Source: BioPlex,STRINGDB
ANKRD17
Tbio
Novelty: 0.05032241
p_int: 0.942286216
p_ni: 0.057713784
Score: 0.187
Data Source: BioPlex,STRINGDB
PRKAR1B
Tbio
Family: Enzyme
Novelty: 0.01102811
p_int: 0.927882478
p_ni: 0.072117323
p_wrong: 1.99e-7
Score: 0.175
Data Source: BioPlex,STRINGDB
WNT7A
Tbio
Novelty: 0.0059354
Score: 0.918
Data Source: STRINGDB
WNT1
Tbio
Novelty: 0.0015436
Score: 0.916
Data Source: STRINGDB
Publication Statistics
PubMed Score  394.72

PubMed score by year
PubTator Score  124.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCS
1-70
AVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPE
70-140
AIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSG
140-210
CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQL
210-280
SKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV
280-346
MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV