You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
FGFR2
Fibroblast growth factor receptor 2

Protein Summary
Description
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation, migration and apoptosis, and in the regulation of embryonic development. Required for normal embryonic patterning, trophoblast function, limb bud development, lung morphogenesis, osteogenesis and skin development. Plays an essential role in the regulation of osteoblast differentiation, proliferation and apoptosis, and is required for normal skeleton development. Promotes cell proliferation in keratinocytes and immature osteoblasts, but promotes apoptosis in differentiated osteoblasts. Phosphorylates PLCG1, FRS2 and PAK4. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activatio ...more
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
1
protein domain
1
PubMedID
1
phenotype
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1283.17   (req: < 5)
Gene RIFs: 419   (req: <= 3)
Antibodies: 1176   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1283.17   (req: >= 5)
Gene RIFs: 419   (req: > 3)
Antibodies: 1176   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 118
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 646
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Active Ligands (646)
1 – 10 of 646
CHEMBL388978
chemical structure image
CHEMBL495727
chemical structure image
CHEMBL3984039,CHEMBL3962736
chemical structure image
CHEMBL1822792
chemical structure image
CHEMBL1784637
chemical structure image
CHEMBL3907195,CHEMBL3944340
chemical structure image
CHEMBL3931421,CHEMBL3955800
chemical structure image
CHEMBL3919730,CHEMBL3967645
chemical structure image
CHEMBL3927451,CHEMBL3902353
chemical structure image
CHEMBL3897101,CHEMBL3935825
chemical structure image
Protein Data Bank (40)
1 – 5 of 40
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (84)
Activated point mutants of FGFR2 (R-HSA-2033519)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 43
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activated point mutants of FGFR2
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Name
Explore in Pharos
Explore in Source
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
Gene Ontology Terms (133)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (310)
1 – 10 of 310
FGFR3
Tclin
Family: Kinase
Novelty: 0.00092116
p_int: 1
Score: 0.965
Data Source: BioPlex,STRINGDB
FGFR1
Tclin
Family: Kinase
Novelty: 0.00068893
p_int: 0.999999818
p_ni: 1.78e-7
p_wrong: 4e-9
Score: 0.385
Data Source: BioPlex,STRINGDB
FGF2
Tchem
Novelty: 0.00009754
p_int: 0.999999577
p_ni: 4.23e-7
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
SNX24
Tdark
Novelty: 2.47058824
p_int: 0.999999179
p_ni: 8.21e-7
Score: 0.189
Data Source: BioPlex,STRINGDB
GAPVD1
Tbio
Family: Enzyme
Novelty: 0.17216643
p_int: 0.999998428
p_ni: 0.000001572
Score: 0.173
Data Source: BioPlex,STRINGDB
C8orf74
Tdark
p_int: 0.999998346
p_ni: 0.000001653
p_wrong: 1e-9
Score: 0.455
Data Source: BioPlex,STRINGDB
SNX22
Tdark
Novelty: 0.61538462
p_int: 0.999996333
p_ni: 0.000003636
p_wrong: 3.1e-8
Score: 0.734
Data Source: BioPlex,STRINGDB
UBE4A
Tbio
Novelty: 0.02208249
p_int: 0.99999342
p_ni: 0.000006577
p_wrong: 3e-9
Score: 0.305
Data Source: BioPlex,STRINGDB
IP6K1
Tbio
Family: Kinase
Novelty: 0.02925139
p_int: 0.999993228
p_ni: 0.000006772
Score: 0.23
Data Source: BioPlex,STRINGDB
RPS6KA3
Tchem
Family: Kinase
Novelty: 0.00292563
p_int: 0.999984207
p_ni: 0.000015792
Score: 0.239
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1283.17

PubMed score by year
PubTator Score  1067.77

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVI
1-70
SWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGA
70-140
EDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVR
140-210
NQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKV
210-280
YSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGI
280-350
SFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK
350-420
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEG
420-490
CFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL
490-560
YVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAAR
560-630
NVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLG
630-700
GSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYL
700-770
DLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
770-821
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT