You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CLDN4
Claudin-4

Protein Summary
Description
Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq, Sep 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340958
  • ENSP00000342445
  • ENSG00000189143
  • ENST00000431918
  • ENSP00000388639
  • ENST00000435050
  • ENSP00000409544

Symbol
  • CPER
  • CPETR1
  • WBSCR8
  • CPER
  • CPE-R
  • CPETR
  • CPETR1
  • WBSCR8
  • hCPE-R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.96
transcription factor binding site profile
0.69
disease perturbation
0.68
disease
0.67
chemical
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 401.7   (req: < 5)
Gene RIFs: 118   (req: <= 3)
Antibodies: 532   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 401.7   (req: >= 5)
Gene RIFs: 118   (req: > 3)
Antibodies: 532   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (118)
Cell junction organization (R-HSA-446728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell junction organization
Reactome
Cell-Cell communication
Reactome
Cell-cell junction organization
Reactome
Tight junction interactions
Name
Explore in Pharos
Explore in Source
Cell junction organization
Cell-Cell communication
Cell-cell junction organization
Tight junction interactions
Protein-Protein Interactions (126)
1 – 10 of 126
CLDN12
Tbio
Novelty: 0.06470623
Score: 0.979
Data Source: STRINGDB
OCLN
Tbio
Novelty: 0.00062788
Score: 0.947
Data Source: STRINGDB
CLDN7
Tbio
Novelty: 0.00860191
Score: 0.937
Data Source: STRINGDB
CLDN3
Tbio
Novelty: 0.00374279
Score: 0.933
Data Source: STRINGDB
CLDN23
Tbio
Novelty: 0.16372511
Score: 0.93
Data Source: STRINGDB
CLDN16
Tbio
Novelty: 0.0103486
Score: 0.919
Data Source: STRINGDB
CLDN11
Tbio
Novelty: 0.00250727
Score: 0.915
Data Source: STRINGDB
CLDN8
Tbio
Novelty: 0.03010422
Score: 0.912
Data Source: STRINGDB
CLDN18
Tbio
Novelty: 0.01754685
Score: 0.911
Data Source: STRINGDB
CLDN1
Tbio
Novelty: 0.00729249
Score: 0.911
Data Source: STRINGDB
Publication Statistics
PubMed Score  401.70

PubMed score by year
PubTator Score  333

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSL
1-70
LALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTA
70-140
HNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
140-209
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV