Protein Classes
Protein Summary
Involved in the activation of Ras protein signal transduction (PubMed:22821884). Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (PubMed:12740440, PubMed:14500341, PubMed:9020151). This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated ...more
- ENST00000311189
- ENSP00000309845
- ENSG00000174775
- ENST00000397594
- ENSP00000380722
- ENST00000397596
- ENSP00000380723
- ENST00000417302
- ENSP00000388246
- ENST00000451590
- ENSP00000407586
- ENST00000493230
- ENSP00000434023
- ENST00000610977
- ENSP00000480686
- ENSG00000276536
- ENST00000615062
- ENSP00000482366
- ENST00000616241
- ENSP00000480317
- ENST00000631404
- ENSP00000488757
- ENST00000631967
- ENSP00000488225
- ENST00000634098
- ENSP00000488296
- HRAS1
- CTLO
- KRAS
- HAMSV
- HRAS1
- KRAS2
- RASH1
- RASK2
- Ki-Ras
- p21ras
- C-H-RAS
- c-K-ras
- H-RASIDX
- c-Ki-ras
- C-BAS/HAS
- C-HA-RAS1
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
biological process | 1 | ||
pathway | 1 | ||
chemical | 0.99 | ||
hub protein | 0.99 | ||
phenotype | 0.94 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 10062.77 (req: < 5)
Gene RIFs: 463 (req: <= 3)
Antibodies: 683 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 10062.77 (req: >= 5)
Gene RIFs: 463 (req: > 3)
Antibodies: 683 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 49
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 9
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
Active Ligands (9)
1 – 9 of 9
Protein Data Bank (168)
1 – 5 of 168
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (334)
Reactome (126)
KEGG (77)
PathwayCommons (72)
WikiPathways (59)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 126
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Activated NTRK2 signals through FRS2 and FRS3 | ||||
Reactome | Activated NTRK2 signals through RAS | ||||
Reactome | Activated NTRK3 signals through RAS | ||||
Reactome | Activation of NMDA receptors and postsynaptic events | ||||
Reactome | Activation of RAS in B cells | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Activated NTRK2 signals through FRS2 and FRS3 | ||||
Activated NTRK2 signals through RAS | ||||
Activated NTRK3 signals through RAS | ||||
Activation of NMDA receptors and postsynaptic events | ||||
Activation of RAS in B cells | ||||
Gene Ontology Terms (57)
Functions (4)
Components (8)
Processes (45)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | WormBase | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Mutant Phenotype (IMP) | CAFA | |||
Protein-Protein Interactions (1037)
1 – 10 of 1037
RIN1
Novelty: 0.02228321
p_int: 0.999920775
p_ni: 0.000079225
Score: 0.964
Data Source: BioPlex,STRINGDB
BRAF
Family: Kinase
Novelty: 0.00382184
p_int: 0.998682404
p_ni: 0.001317591
p_wrong: 5e-9
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
RABGGTB
Family: Enzyme
Novelty: 0.13346044
p_int: 0.994792299
p_ni: 0.005207631
p_wrong: 7e-8
Score: 0.263
Data Source: BioPlex,STRINGDB
RGL1
Novelty: 0.01382117
p_int: 0.992532424
p_ni: 0.007165967
p_wrong: 0.000301609
Score: 0.948
Data Source: BioPlex,STRINGDB
TMEM185A
Novelty: 0.03619125
p_int: 0.992224121
p_ni: 0.007775844
p_wrong: 3.5e-8
Score: 0.285
Data Source: BioPlex,STRINGDB
CYP2S1
Novelty: 0.04038753
p_int: 0.989422085
p_ni: 0.010577901
p_wrong: 1.4e-8
Score: 0.295
Data Source: BioPlex,STRINGDB
DUSP22
Family: Enzyme
Novelty: 0.02012116
p_int: 0.981653786
p_ni: 0.018345936
p_wrong: 2.77e-7
Score: 0.261
Data Source: BioPlex,STRINGDB
SLC25A41
Family: Transporter
Novelty: 2.02597403
p_int: 0.977822329
p_ni: 0.015359264
p_wrong: 0.006818408
Data Source: BioPlex
ATG3
Novelty: 0.00966067
p_int: 0.977406914
p_ni: 0.020816048
p_wrong: 0.001777038
Score: 0.32
Data Source: BioPlex,STRINGDB
VDAC3
Novelty: 0.01448609
p_int: 0.977028169
p_ni: 0.022970652
p_wrong: 0.000001179
Score: 0.459
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 10062.77
PubMed score by year
PubTator Score 1772.19
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ
1-70
YMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIP
70-140
YIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
140-189
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
Find similar targets by: