You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PMS1
PMS1 protein homolog 1

Protein Summary
Description
Probably involved in the repair of mismatches in DNA. This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000409593
  • ENSP00000387169
  • ENSG00000064933
  • ENST00000409823
  • ENSP00000387125
  • ENST00000441310
  • ENSP00000406490
  • ENST00000447232
  • ENSP00000401064

Symbol
  • PMSL1
  • MLH2
  • PMSL1
  • hPMS1
  • HNPCC3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
protein domain
0.92
histone modification site profile
0.89
transcription factor binding site profile
0.72
hub protein
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 198.03   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 309   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 198.03   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 309   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (10)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (125)
1 – 10 of 125
MLH1
Tbio
Novelty: 0.00040798
p_int: 0.999999977
p_ni: 2.3e-8
Score: 0.969
Data Source: BioPlex,STRINGDB
HIST1H1D
Tbio
Novelty: 0.01416988
p_int: 0.999415776
p_ni: 0.000584222
p_wrong: 1e-9
Score: 0.645
Data Source: BioPlex,STRINGDB
PSMC3
Tbio
Family: Enzyme
Novelty: 0.0502828
p_int: 0.997220403
p_ni: 0.002779597
Score: 0.15
Data Source: BioPlex,STRINGDB
SNX21
Tdark
Novelty: 0.82677165
p_int: 0.995248217
p_ni: 0.001610794
p_wrong: 0.00314099
Score: 0.158
Data Source: BioPlex,STRINGDB
CAPN2
Tchem
Novelty: 0.00479454
p_int: 0.973019682
p_ni: 0.026956692
p_wrong: 0.000023626
Data Source: BioPlex
BBS7
Tbio
Novelty: 0.06755563
p_int: 0.972412053
p_ni: 0.027586923
p_wrong: 0.000001025
Data Source: BioPlex
PAG1
Tbio
Novelty: 0.0206299
p_int: 0.941155474
p_ni: 0.058831036
p_wrong: 0.00001349
Data Source: BioPlex
AHNAK
Tbio
Novelty: 0.01530578
p_int: 0.917121143
p_ni: 0.082878857
Score: 0.177
Data Source: BioPlex,STRINGDB
VAMP3
Tbio
Novelty: 0.00974462
p_int: 0.913787632
p_ni: 0.085882605
p_wrong: 0.000329763
Data Source: BioPlex
HRAS
Tchem
Family: Enzyme
Novelty: 0.00008788
p_int: 0.842062876
p_ni: 0.155351682
p_wrong: 0.002585442
Score: 0.428
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  198.03

PubMed score by year
PubTator Score  96.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMA
1-70
MKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADNFSTQYVLDGSGHILSQKPSHLGQG
70-140
TTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFGILKPDLRIVFVHNKAVIWQKSRVSDHKMAL
140-210
MSVLGTAVMNNMESFQYHSEESQIYLSGFLPKCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHY
210-280
NLKCLKESTRLYPVFFLKIDVPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLPSTNSYENNK
280-350
TDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGH
350-420
CSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENS
420-490
SEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKV
490-560
TAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEEKLKYEEKATKDLER
560-630
YNSQMKRAIEQESQMSLKDGRKKIKPTSAWNLAQKHKLKTSLSNQPKLDELLQSQIEKRRSQNIKMVQIP
630-700
FSMKNLKINFKKQNKVDLEEKDEPCLIHNLRFPDAWLMTSKTEVMLLNPYRVEEALLFKRLLENHKLPAE
700-770
PLEKPIMLTESLFNGSHYLDVLYKMTADDQRYSGSTYLSDPRLTANGFKIKLIPGVSITENYLEIEGMAN
770-840
CLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFGN
840-910
EIKECVHGRPFFHHLTYLPETT
910-932
MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADNFSTQYVLDGSGHILSQKPSHLGQGTTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFGILKPDLRIVFVHNKAVIWQKSRVSDHKMALMSVLGTAVMNNMESFQYHSEESQIYLSGFLPKCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKIDVPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEEKLKYEEKATKDLERYNSQMKRAIEQESQMSLKDGRKKIKPTSAWNLAQKHKLKTSLSNQPKLDELLQSQIEKRRSQNIKMVQIPFSMKNLKINFKKQNKVDLEEKDEPCLIHNLRFPDAWLMTSKTEVMLLNPYRVEEALLFKRLLENHKLPAEPLEKPIMLTESLFNGSHYLDVLYKMTADDQRYSGSTYLSDPRLTANGFKIKLIPGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFGNEIKECVHGRPFFHHLTYLPETT