You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
TNF
Tumor necrosis factor

Protein Summary
Description
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208). Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line (PubMed:22517918, PubMed:16829952, PubMed:23396208). Induces insulin resistance in adipocytes via inhibition of insulin-induce ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000376122
  • ENSP00000365290
  • ENSG00000204490
  • ENST00000383496
  • ENSP00000372988
  • ENSG00000206439
  • ENST00000412275
  • ENSP00000392858
  • ENSG00000228321
  • ENST00000420425
  • ENSP00000410668
  • ENSG00000228849
  • ENST00000443707
  • ENSP00000389492
  • ENSG00000230108
  • ENST00000448781
  • ENSP00000389490
  • ENSG00000223952
  • ENST00000449264
  • ENSP00000398698
  • ENSG00000232810

Symbol
  • TNFA
  • TNFSF2
  • DIF
  • TNFA
  • TNFSF2
  • TNLG1F
  • TNF-alpha
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
1
virus perturbation
1
drug
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 49978.25   (req: < 5)
Gene RIFs: 4125   (req: <= 3)
Antibodies: 4430   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 49978.25   (req: >= 5)
Gene RIFs: 4125   (req: > 3)
Antibodies: 4430   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 145
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 351
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 5
Protein Data Bank (23)
1 – 5 of 23
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (154)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Death Receptor Signalling
Reactome
Developmental Biology
Reactome
Immune System
Reactome
Interleukin-10 signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Death Receptor Signalling
Developmental Biology
Immune System
Interleukin-10 signaling
Gene Ontology Terms (156)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
ARUK-UCL
Protein-Protein Interactions (1287)
1 – 10 of 1287
TNFRSF1A
Tchem
Novelty: 0.00048442
p_int: 0.999996794
p_ni: 0.000002275
p_wrong: 9.3e-7
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
DAG1
Tbio
Family: Enzyme
Novelty: 0.00185637
p_int: 0.997018043
p_ni: 0.002981832
p_wrong: 1.25e-7
Score: 0.205
Data Source: BioPlex,STRINGDB
HSPA13
Tbio
Novelty: 0.07792834
p_int: 0.988975416
p_ni: 0.011024584
Score: 0.603
Data Source: BioPlex,STRINGDB
GUF1
Tbio
Novelty: 0.00666297
p_int: 0.979527956
p_ni: 0.019640972
p_wrong: 0.000831072
Score: 0.2
Data Source: BioPlex,STRINGDB
SFXN5
Tdark
Novelty: 0.44295302
p_int: 0.974090509
p_ni: 0.024865901
p_wrong: 0.00104359
Data Source: BioPlex
NEK7
Tchem
Family: Kinase
Novelty: 0.03876863
p_int: 0.973352473
p_ni: 0.02658634
p_wrong: 0.000061187
Score: 0.161
Data Source: BioPlex,STRINGDB
PLXNA2
Tbio
Novelty: 0.00307834
p_int: 0.963544518
p_ni: 0.036404988
p_wrong: 0.000050495
Score: 0.153
Data Source: BioPlex,STRINGDB
GK
Tbio
Family: Kinase
Novelty: 0.00835719
p_int: 0.961262842
p_ni: 0.038737158
Score: 0.202
Data Source: BioPlex,STRINGDB
CAPNS1
Tbio
Novelty: 0.00108655
p_int: 0.960139914
p_ni: 0.039860086
Score: 0.328
Data Source: BioPlex,STRINGDB
HSPA12A
Tbio
Novelty: 0.22231241
p_int: 0.956488665
p_ni: 0.043511328
p_wrong: 7e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  49978.25

PubMed score by year
PubTator Score  45431.67

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLI
1-70
SPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLF
70-140
KGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSA
140-210
EINRPDYLDFAESGQVYFGIIAL
210-233
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL