Protein Summary
Cytokine that promotes the proliferation, survival and differentiation of monocytes and macrophages. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, and in the regulation of bone resorption. Signaling via CSF1R and its downstream effectors stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1. Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 [PubMed 18467591]).[supplied by OMIM, May 2008]
- ENST00000288098
- ENSP00000288098
- ENSG00000157368
- ENST00000429149
- ENSP00000397863
- C16orf77
- IL-34
- C16orf77
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
transcription factor | 0.6 | ||
tissue sample | 0.53 | ||
cell type or tissue | 0.51 | ||
PubMedID | 0.5 | ||
biological process | 0.47 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 98.92 (req: < 5)
Gene RIFs: 39 (req: <= 3)
Antibodies: 350 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 98.92 (req: >= 5)
Gene RIFs: 39 (req: > 3)
Antibodies: 350 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 11
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (6)
Reactome (4)
KEGG (2)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 4 of 4
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Cytokine Signaling in Immune system | ||||
Reactome | Immune System | ||||
Reactome | Other interleukin signaling | ||||
Reactome | Signaling by Interleukins | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Cytokine Signaling in Immune system | ||||
Immune System | ||||
Other interleukin signaling | ||||
Signaling by Interleukins | ||||
Gene Ontology Terms (13)
Functions (4)
Components (2)
Processes (7)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | IntAct | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Protein-Protein Interactions (35)
1 – 10 of 35
CSF1R
Family: Kinase
Novelty: 0.00058475
Score: 0.998
Data Source: Reactome,STRINGDB
CSF1
Novelty: 0.00068583
Score: 0.974
Data Source: Reactome,STRINGDB
PTPRZ1
Family: Enzyme
Novelty: 0.00645203
Score: 0.932
Data Source: Reactome,STRINGDB
SDC1
Novelty: 0.0006457
Score: 0.907
Data Source: Reactome,STRINGDB
TLR3
Novelty: 0.00056226
Score: 0.689
Data Source: STRINGDB
TRAF3
Novelty: 0.00292884
Score: 0.549
Data Source: STRINGDB
IL1B
Novelty: 0.00003644
Score: 0.536
Data Source: STRINGDB
DNALI1
Novelty: 0.25184889
Score: 0.526
Data Source: STRINGDB
TREM2
Novelty: 0.00295722
Score: 0.517
Data Source: STRINGDB
SPI1
Family: TF
Novelty: 0.0008303
Score: 0.515
Data Source: STRINGDB
Publication Statistics
PubMed Score 98.92
PubMed score by year
PubTator Score 65.56
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG
1-70
VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVETLLLNVQQGLTDVEVSP
70-140
KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT
140-210
QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP
210-242
MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEGVFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP
Find similar targets by: