Protein Classes
Protein Summary
Seems to promote the survival of visceral and proprioceptive sensory neurons. The protein encoded by this gene is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor and brain-derived neurotrophic factor. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NTF3-deficient mice generated by gene targeting display severe movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. [provided by RefSeq, Jul 2008]
- ENST00000331010
- ENSP00000328738
- ENSG00000185652
- ENST00000423158
- ENSP00000397297
- NT3
- HDNF
- NGF2
- NT-3
- NGF-2
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
biological process | 0.99 | ||
gene perturbation | 0.97 | ||
biological term | 0.77 | ||
disease | 0.77 | ||
chemical | 0.73 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1294.83 (req: < 5)
Gene RIFs: 72 (req: <= 3)
Antibodies: 578 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1294.83 (req: >= 5)
Gene RIFs: 72 (req: > 3)
Antibodies: 578 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 30
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (64)
Reactome (10)
KEGG (4)
PathwayCommons (10)
WikiPathways (40)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 10
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Activated NTRK3 signals through PI3K | ||||
Reactome | Activated NTRK3 signals through PLCG1 | ||||
Reactome | Activated NTRK3 signals through RAS | ||||
Reactome | NTF3 activates NTRK2 (TRKB) signaling | ||||
Reactome | NTF3 activates NTRK3 signaling | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Activated NTRK3 signals through PI3K | ||||
Activated NTRK3 signals through PLCG1 | ||||
Activated NTRK3 signals through RAS | ||||
NTF3 activates NTRK2 (TRKB) signaling | ||||
NTF3 activates NTRK3 signaling | ||||
Gene Ontology Terms (36)
Functions (4)
Components (6)
Processes (26)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Traceable Author Statement (TAS) | ProtInc | |||
Inferred from Electronic Annotation (IEA) | InterPro | |||
Protein-Protein Interactions (199)
1 – 10 of 199
KCTD18
Novelty: 1.42857143
p_int: 0.999607417
p_ni: 0.000004662
p_wrong: 0.000387921
Data Source: BioPlex
MAD2L1BP
Novelty: 0.86956522
p_int: 0.983134945
p_ni: 0.000349583
p_wrong: 0.016515472
Score: 0.519
Data Source: BioPlex,STRINGDB
METTL5
Family: Enzyme
Novelty: 0.4
p_int: 0.976928626
p_ni: 1.4e-8
p_wrong: 0.02307136
Data Source: BioPlex
HSPA5
Novelty: 0.00051387
p_int: 0.973868514
p_ni: 0.026131486
Data Source: BioPlex
PYGB
Family: Enzyme
Novelty: 0.0023816
p_int: 0.899326478
p_ni: 0.100673522
Score: 0.201
Data Source: BioPlex,STRINGDB
PYGL
Family: Enzyme
Novelty: 0.01061209
p_int: 0.831239695
p_ni: 0.168760306
Score: 0.519
Data Source: BioPlex,STRINGDB
NTRK3
Family: Kinase
Novelty: 0.00241438
Score: 0.998
Data Source: Reactome,STRINGDB
NTRK2
Family: Kinase
Novelty: 0.00060827
Score: 0.997
Data Source: Reactome,STRINGDB
NTRK1
Family: Kinase
Novelty: 0.0004431
Score: 0.996
Data Source: STRINGDB
NGFR
Novelty: 0.00089072
Score: 0.996
Data Source: STRINGDB
Publication Statistics
PubMed Score 1294.83
PubMed score by year
PubTator Score 548.99
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPR
1-70
EPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYA
70-140
EHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDD
140-210
KHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
210-257
MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
Find similar targets by: