You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
TBXA2R
Thromboxane A2 receptor

Protein Summary
Description
Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C. Isoform 1 activates adenylyl cyclase. Isoform 2 inhibits adenylyl cyclase. This gene encodes a member of the G protein-coupled receptor family. The protein interacts with thromboxane A2 to induce platelet aggregation and regulate hemostasis. A mutation in this gene results in a bleeding disorder. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375190
  • ENSP00000364336
  • ENSG00000006638
  • ENST00000411851
  • ENSP00000393333

Symbol
  • TXA2-R
  • BDPLT13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (chemical)
0.96
histone modification site profile
0.81
kinase
0.72
tissue sample
0.69
biological term
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 141.04   (req: < 5)
Gene RIFs: 98   (req: <= 3)
Antibodies: 170   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 141.04   (req: >= 5)
Gene RIFs: 98   (req: > 3)
Antibodies: 170   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 319
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (20)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
Eicosanoid ligand-binding receptors
Reactome
G alpha (12/13) signalling events
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
Eicosanoid ligand-binding receptors
G alpha (12/13) signalling events
G alpha (q) signalling events
GPCR downstream signalling
Protein-Protein Interactions (221)
1 – 10 of 221
TGM2
Tchem
Family: Enzyme
Novelty: 0.00048324
Score: 0.986
Data Source: STRINGDB
GNAQ
Tbio
Novelty: 0.00176666
Score: 0.968
Data Source: Reactome,STRINGDB
LTB4R
Tchem
Family: GPCR
Novelty: 0.00174481
Score: 0.957
Data Source: STRINGDB
GNA13
Tbio
Novelty: 0.05970556
Score: 0.955
Data Source: Reactome,STRINGDB
ADRA1B
Tclin
Family: GPCR
Novelty: 0.00098873
Score: 0.953
Data Source: STRINGDB
ARRB2
Tbio
Novelty: 0.00180049
Score: 0.952
Data Source: STRINGDB
GNAI2
Tbio
Novelty: 0.04542644
Score: 0.952
Data Source: STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.95
Data Source: Reactome,STRINGDB
GNG2
Tbio
Novelty: 0.08273543
Score: 0.949
Data Source: Reactome,STRINGDB
GRK5
Tchem
Family: Kinase
Novelty: 0.01219315
Score: 0.948
Data Source: STRINGDB
Publication Statistics
PubMed Score  141.04

PubMed score by year
PubTator Score  205.93

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGL
1-70
VLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSR
70-140
PAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGL
140-210
SFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAG
210-280
QLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
280-343
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ