You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
MTMR11
Myotubularin-related protein 11

Protein Classes
Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369140
  • ENSP00000358136
  • ENSG00000014914
  • ENST00000439741
  • ENSP00000391668

Symbol
  • CRA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.79
transcription factor perturbation
0.74
gene perturbation
0.7
small molecule perturbation
0.69
tissue sample
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.65   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 46   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.65   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 46   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (11)
1 – 10 of 11
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.842556224
p_ni: 0.157443776
Data Source: BioPlex
ANKRD40
Tdark
p_int: 0.828808093
p_ni: 0.171191907
Data Source: BioPlex
OR10H2
Tdark
Family: oGPCR
Score: 0.63
Data Source: STRINGDB
TMEM205
Tdark
Novelty: 0.57352941
Score: 0.512
Data Source: STRINGDB
ACAD8
Tbio
Family: Enzyme
Novelty: 0.08534535
Score: 0.504
Data Source: STRINGDB
ZNF212
Tdark
Family: TF
Novelty: 1.30232558
Score: 0.427
Data Source: STRINGDB
SKIV2L
Tbio
Family: Enzyme
Novelty: 0.01651455
Score: 0.423
Data Source: STRINGDB
POLD4
Tdark
Family: Enzyme
Novelty: 0.28985507
Score: 0.416
Data Source: STRINGDB
DUSP10
Tbio
Family: Enzyme
Novelty: 0.02533584
Score: 0.41
Data Source: STRINGDB
TRMT9B
Tbio
Family: Enzyme
Novelty: 0.25862069
Score: 0.403
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.65

PubMed score by year
PubTator Score  250.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWWGGRGQSFNIAPQKEEPEMGSVQENRMPEPRSRQPSSCLASRCLPGEQILAWAPGVRKGLEPELSGTL
1-70
ICTNFRVTFQPCGWQWNQDTPLNSEYDFALVNIGRLEAVSGLSRVQLLRPGSLHKFIPEEILIHGRDFRL
70-140
LRVGFEAGGLEPQAFQVTMAIVQARAQSNQAQQYSGITLSKAGQGSGSRKPPIPLMETAEDWETERKKQA
140-210
ARGWRVSTVNERFDVATSLPRYFWVPNRILDSEVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASD
210-280
PNKEDIRAVELMLQAGHSDVVLVDTMDELPSLADVQLAHLRLRALCLPDSSVAEDKWLSALEGTRWLDYV
280-350
RACLRKASDISVLVTSRVRSVILQERGDRDLNGLLSSLVQLLSAPEARTLFGFQSLVQREWVAAGHPFLT
350-420
RLGGTGASEEAPVFLLFLDCVWQLLQQFPADFEFSEFFLLALHDSVRVPDTLTFLRNTPWERGKQSGQLN
420-490
SYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHCPDSWLPRPQPSFMVPGPPSS
490-560
VWLFSRGALTPLNQLCPWRDSPSLLAVSSRWLPRPAISSESLADQEWGLPSHWGACPLPPGLLLPGYLGP
560-630
QIRLWRRCYLRGRPEVQMGLSAPTISGLQDELSHLQELLRKWTPRISPEDHSKKRDPHTILNPTEIAGIL
630-700
KGRAEGDLG
700-709
MWWGGRGQSFNIAPQKEEPEMGSVQENRMPEPRSRQPSSCLASRCLPGEQILAWAPGVRKGLEPELSGTLICTNFRVTFQPCGWQWNQDTPLNSEYDFALVNIGRLEAVSGLSRVQLLRPGSLHKFIPEEILIHGRDFRLLRVGFEAGGLEPQAFQVTMAIVQARAQSNQAQQYSGITLSKAGQGSGSRKPPIPLMETAEDWETERKKQAARGWRVSTVNERFDVATSLPRYFWVPNRILDSEVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDVVLVDTMDELPSLADVQLAHLRLRALCLPDSSVAEDKWLSALEGTRWLDYVRACLRKASDISVLVTSRVRSVILQERGDRDLNGLLSSLVQLLSAPEARTLFGFQSLVQREWVAAGHPFLTRLGGTGASEEAPVFLLFLDCVWQLLQQFPADFEFSEFFLLALHDSVRVPDTLTFLRNTPWERGKQSGQLNSYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHCPDSWLPRPQPSFMVPGPPSSVWLFSRGALTPLNQLCPWRDSPSLLAVSSRWLPRPAISSESLADQEWGLPSHWGACPLPPGLLLPGYLGPQIRLWRRCYLRGRPEVQMGLSAPTISGLQDELSHLQELLRKWTPRISPEDHSKKRDPHTILNPTEIAGILKGRAEGDLG