You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZSCAN31
Zinc finger and SCAN domain-containing protein 31

Protein Summary
Description
May function as a transcription factor. May be involved in the development of multiple embryonic organs. This gene encodes a protein containing multiple C2H2-type zinc finger motifs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000344279
  • ENSP00000345339
  • ENSG00000235109
  • ENST00000396838
  • ENSP00000380050
  • ENST00000414429
  • ENSP00000390076
  • ENST00000439158
  • ENSP00000413705
  • ENST00000446474
  • ENSP00000402937
  • ENST00000611469
  • ENSP00000480254

Symbol
  • ZNF310P
  • ZNF323
  • ZNF323
  • ZNF310P
  • ZNF20-Lp
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.76
protein domain
0.73
trait
0.61
microRNA
0.56
phenotype
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.07   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 117   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.07   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 117   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (30)
1 – 10 of 30
MTMR4
Tbio
Family: Enzyme
Novelty: 0.13561876
p_int: 0.948621017
p_ni: 0.050264651
p_wrong: 0.001114333
Data Source: BioPlex
PIP5K1A
Tbio
Family: Kinase
Novelty: 0.08213456
p_int: 0.926994145
p_ni: 0.073005855
Score: 0.159
Data Source: BioPlex,STRINGDB
CDKN2AIP
Tbio
Novelty: 0.20403206
p_int: 0.926571831
p_ni: 0.07341911
p_wrong: 0.000009059
Score: 0.19
Data Source: BioPlex,STRINGDB
DHX57
Tdark
Family: Enzyme
Novelty: 1.71428571
p_int: 0.925513236
p_ni: 0.074486764
Data Source: BioPlex
THAP11
Tbio
Family: TF
Novelty: 0.06994842
p_int: 0.918408156
p_ni: 0.081587711
p_wrong: 0.000004133
Score: 0.179
Data Source: BioPlex,STRINGDB
LENG8
Tdark
Novelty: 1.43610201
p_int: 0.917694712
p_ni: 0.082298527
p_wrong: 0.000006761
Score: 0.173
Data Source: BioPlex,STRINGDB
RPL26L1
Tdark
Novelty: 2
p_int: 0.913795065
p_ni: 0.086204935
Data Source: BioPlex
TRMT1L
Tdark
Novelty: 0.85714286
p_int: 0.88422317
p_ni: 0.115776829
p_wrong: 1e-9
Score: 0.163
Data Source: BioPlex,STRINGDB
YTHDC2
Tbio
Family: Enzyme
Novelty: 0.18840993
p_int: 0.85240375
p_ni: 0.14759625
Score: 0.183
Data Source: BioPlex,STRINGDB
PDCD11
Tbio
Novelty: 0.02896416
p_int: 0.820513825
p_ni: 0.179486175
Score: 0.173
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  3.07

PubMed score by year
PubTator Score  3.3

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRLRELCHQWLRP
1-70
EIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLL
70-140
EDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDV
140-210
SLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRS
210-280
SLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKR
280-350
YQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP
350-406
MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP