Protein Classes
Protein Summary
Inflammatory caspase (PubMed:7797510, PubMed:23516580, PubMed:25119034). Essential effector of NLRP3 inflammasome-dependent CASP1 activation and IL1B and IL18 secretion in response to non-canonical activators, such as UVB radiation, cholera enterotoxin subunit B and cytosolic LPS (PubMed:22246630, PubMed:26174085, PubMed:26173988, PubMed:26508369, PubMed:25964352). Independently of NLRP3 inflammasome and CASP1, promotes pyroptosis, through GSDMD cleavage and activation, and IL1A, IL18 and HMGB1 release in response to non-canonical inflammasome activators (PubMed:24879791, PubMed:25964352). Plays a crucial role in the restriction of Salmonella typhimurium replication in colonic epithelial cells during infection (PubMed:25121752). In later stages of the infection, LPS from cytosolic Salmonella triggers CASP4 activation, which ultimately results in pyroptosis of infected cells and their extrusion into the gut lumen, as well as in IL18 secretion. Pyroptosis limits bacterial replication, wh ...more
- ENST00000393150
- ENSP00000376857
- ENSG00000196954
- ENST00000444739
- ENSP00000388566
- ICH2
- TX
- Mih1
- ICH-2
- Mih1/TX
- ICEREL-II
- ICE(rel)II
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
virus perturbation | 1 | ||
protein domain | 0.99 | ||
disease perturbation | 0.93 | ||
PubMedID | 0.92 | ||
transcription factor perturbation | 0.8 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 167.02 (req: < 5)
Gene RIFs: 42 (req: <= 3)
Antibodies: 673 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 167.02 (req: >= 5)
Gene RIFs: 42 (req: > 3)
Antibodies: 673 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 12
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 21
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Active Ligands (21)
1 – 10 of 21
Pathways (168)
Reactome (4)
KEGG (1)
PathwayCommons (1)
WikiPathways (162)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 4 of 4
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Immune System | ||||
Reactome | Innate Immune System | ||||
Reactome | NOD1/2 Signaling Pathway | ||||
Reactome | Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Immune System | ||||
Innate Immune System | ||||
NOD1/2 Signaling Pathway | ||||
Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | ||||
Gene Ontology Terms (21)
Functions (3)
Components (9)
Processes (9)
Items per page:
10
1 – 3 of 3
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Protein-Protein Interactions (78)
1 – 10 of 78
CASP5
Family: Enzyme
Novelty: 0.00907686
p_int: 0.999999847
p_ni: 5e-9
p_wrong: 1.48e-7
Score: 0.893
Data Source: BioPlex,STRINGDB
CASP1
Family: Enzyme
Novelty: 0.00043112
Score: 0.964
Data Source: STRINGDB
NOD1
Novelty: 0.00337321
Score: 0.955
Data Source: STRINGDB
GSDMD
Novelty: 0.01231428
Score: 0.944
Data Source: STRINGDB
CASP8
Family: Enzyme
Novelty: 0.00026844
Score: 0.913
Data Source: STRINGDB
APAF1
Family: Enzyme
Novelty: 0.00164778
Score: 0.904
Data Source: STRINGDB
EIF4A1
Novelty: 0.0043238
Score: 0.904
Data Source: STRINGDB
EIF4E
Novelty: 0.00088513
Score: 0.901
Data Source: STRINGDB
EIF4G3
Novelty: 0.04202311
Score: 0.9
Data Source: STRINGDB
EIF4G1
Novelty: 0.00219215
Score: 0.9
Data Source: STRINGDB
Publication Statistics
PubMed Score 167.02
PubMed score by year
PubTator Score 204.17
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQ
1-70
MLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALI
70-140
ICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSH
140-210
GILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASS
210-280
QSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSF
280-350
ETPRAKAQMPTIERLSMTRYFYLFPGN
350-377
MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMPTIERLSMTRYFYLFPGN
Find similar targets by: