You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZNF845
Zinc finger protein 845

Protein Summary
Description
May be involved in transcriptional regulation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000458035
  • ENSP00000388311
  • ENSG00000213799
  • ENST00000595091
  • ENSP00000470005
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.75
cell line
0.66
protein domain
0.58
microRNA
0.51
transcription factor
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.23   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 73   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.23   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 73   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (11)
1 – 10 of 11
TRIM28
Tbio
Family: Epigenetic
Novelty: 0.01042773
p_int: 0.999975099
p_ni: 0.000008941
p_wrong: 0.000015959
Score: 0.257
Data Source: BioPlex,STRINGDB
GPATCH4
Tdark
Novelty: 2.35294118
p_int: 0.999910069
p_ni: 0.00008105
p_wrong: 0.000008881
Data Source: BioPlex
SART3
Tbio
Novelty: 0.02812047
p_int: 0.967571701
p_ni: 0.000286358
p_wrong: 0.032141941
Data Source: BioPlex
DAP3
Tbio
Novelty: 0.0575752
Score: 0.616
Data Source: STRINGDB
SERGEF
Tdark
Novelty: 0.55408971
Score: 0.55
Data Source: STRINGDB
OR4N4
Tdark
Family: oGPCR
Novelty: 1.15384615
Score: 0.548
Data Source: STRINGDB
PLPP4
Tbio
Family: Enzyme
Novelty: 0.36878578
Score: 0.496
Data Source: STRINGDB
LRRC1
Tbio
Novelty: 0.06567933
Score: 0.447
Data Source: STRINGDB
SEC23IP
Tbio
Novelty: 0.13247818
Score: 0.447
Data Source: STRINGDB
NDUFAF1
Tclin
Novelty: 0.0776632
Score: 0.41
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.23

PubMed score by year
PubTator Score  0.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMKEFSSTAQGNTEVIH
1-70
TGTLQRHERHHIGDFCFQEMEKDIHDFEFQWKEDERNSHEAPMTEIKQLTGSTNRHDQRHAGNKPIKDQL
70-140
GSSFHSHLPELHMFQTEGKIGNQVEKSINSASLVSTSQRISCRPKTHISKNYGNNFLNSSLLTQKQEVHM
140-210
REKSFQCNESGKAFNYSSVLRKHQIIHLGAKQYKCDVCGKVFNQKRYLACHRRCHTGKKPYKCNDCGKTF
210-280
SQELTLTCHHRLHTGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHT
280-350
GEKPYKCEECDKAFSFKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTF
350-420
SQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTSSLVYHRRLHT
420-490
GEKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAF
490-560
RGQSALIYHQAIHGIGKLYKCNDCHQVFSNATTIANHWRIHNEERSYKCNRCGKFFRHRSYLAVHWRTHS
560-630
GEKPYKCEECDEAFSFKSNLQRHRRIHTGEKPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTF
630-700
GRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRLHTGEKPYKCEECDKVFSRKSSLEKHRRIHT
700-770
GEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTF
770-840
RHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLHTGEKPYKCNKCGKVFNQQAHLACHHRIHT
840-910
GEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLARHHRIHTGKKH
910-970
MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMKEFSSTAQGNTEVIHTGTLQRHERHHIGDFCFQEMEKDIHDFEFQWKEDERNSHEAPMTEIKQLTGSTNRHDQRHAGNKPIKDQLGSSFHSHLPELHMFQTEGKIGNQVEKSINSASLVSTSQRISCRPKTHISKNYGNNFLNSSLLTQKQEVHMREKSFQCNESGKAFNYSSVLRKHQIIHLGAKQYKCDVCGKVFNQKRYLACHRRCHTGKKPYKCNDCGKTFSQELTLTCHHRLHTGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFRGQSALIYHQAIHGIGKLYKCNDCHQVFSNATTIANHWRIHNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRLHTGEKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLHTGEKPYKCNKCGKVFNQQAHLACHHRIHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLARHHRIHTGKKH