You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
IL1R1
Interleukin-1 receptor type 1

Protein Summary
Description
Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the coreceptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. Involved in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells (PubMed:10653850). This gene encodes a cytokine receptor that belongs to the interleukin-1 receptor family. The encoded protein is a receptor for interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist. It is an important mediator involved in many cytokine-induced immune and inflammatory responses. This gene is located in a cluster of rel ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000410023
  • ENSP00000386380
  • ENSG00000115594

Symbol
  • IL1R
  • IL1RA
  • IL1RT1
  • P80
  • IL1R
  • IL1RA
  • CD121A
  • D2S1473
  • IL-1R-alpha
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.97
protein domain
0.97
disease
0.9
phenotype
0.81
small molecule perturbation
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 425.84   (req: < 5)
Gene RIFs: 116   (req: <= 3)
Antibodies: 845   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 425.84   (req: >= 5)
Gene RIFs: 116   (req: > 3)
Antibodies: 845   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
anakinra
chemical structure image
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (116)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-1 family signaling
Reactome
Interleukin-1 signaling
Reactome
Interleukin-10 signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-1 family signaling
Interleukin-1 signaling
Interleukin-10 signaling
Gene Ontology Terms (22)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (201)
1 – 10 of 201
ATP2A3
Tbio
Family: Transporter
Novelty: 0.01101086
p_int: 0.969442861
p_ni: 0.030557139
Data Source: BioPlex
ICK
Tchem
Family: Kinase
Novelty: 0.00500695
p_int: 0.930508911
p_ni: 0.001787409
p_wrong: 0.06770368
Score: 0.189
Data Source: BioPlex,STRINGDB
TUBB8
Tclin
Novelty: 0.11569363
p_int: 0.883030189
p_ni: 0.116969811
Data Source: BioPlex
MFAP3
Tdark
Novelty: 1.07142857
p_int: 0.876842001
p_ni: 0.123157998
Score: 0.51
Data Source: BioPlex,STRINGDB
TNFRSF10B
Tbio
Novelty: 0.0006573
p_int: 0.849323484
p_ni: 0.15033393
p_wrong: 0.000342586
Score: 0.404
Data Source: BioPlex,STRINGDB
BMPR1A
Tchem
Family: Kinase
Novelty: 0.00472897
p_int: 0.817128508
p_ni: 0.086153516
p_wrong: 0.096717975
Score: 0.2
Data Source: BioPlex,STRINGDB
IRAK4
Tchem
Family: Kinase
Novelty: 0.00479185
Score: 0.999
Data Source: Reactome,STRINGDB
TRAF6
Tbio
Novelty: 0.00159491
Score: 0.999
Data Source: Reactome,STRINGDB
IRAK1
Tchem
Family: Kinase
Novelty: 0.00254228
Score: 0.999
Data Source: Reactome,STRINGDB
MYD88
Tbio
Novelty: 0.00054413
Score: 0.999
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  425.84

PubMed score by year
PubTator Score  397.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQ
1-70
ASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGL
70-140
VCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPIT
140-210
RVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYS
210-280
VENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIV
280-350
CSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
350-420
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQDGIKVVLLEL
420-490
EKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQLLSPATKEKL
490-560
QREAHVPLG
560-569
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQDGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQLLSPATKEKLQREAHVPLG