You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CD207
C-type lectin domain family 4 member K

Protein Summary
Description
Calcium-dependent lectin displaying mannose-binding specificity. Induces the formation of Birbeck granules (BGs); is a potent regulator of membrane superimposition and zippering. Binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. Facilitates uptake of antigens and is involved in the routing and/or processing of antigen for presentation to T cells. Major receptor on primary Langerhans cells for Candida species, Saccharomyces species, and Malassezia furfur. Protects against human immunodeficiency virus-1 (HIV-1) infection. Binds to high-mannose structures present on the envelope glycoprotein which is followed by subsequent targeting of the virus to the Birbeck granules leading to its rapid degradation. The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of s ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000410009
  • ENSP00000386378
  • ENSG00000116031

Symbol
  • CLEC4K
  • CLEC4K
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.8
gene perturbation
0.71
protein domain
0.58
cell type or tissue
0.57
PubMedID
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 272.63   (req: < 5)
Gene RIFs: 45   (req: <= 3)
Antibodies: 428   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 272.63   (req: >= 5)
Gene RIFs: 45   (req: > 3)
Antibodies: 428   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (20)
1 – 5 of 20
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing-Cross presentation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
Cross-presentation of soluble exogenous antigens (endosomes)
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing-Cross presentation
Class I MHC mediated antigen processing & presentation
Cross-presentation of soluble exogenous antigens (endosomes)
Immune System
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (84)
1 – 10 of 84
TBC1D22B
Tbio
Novelty: 6
p_int: 0.99999961
p_ni: 3.78e-7
p_wrong: 1.2e-8
Data Source: BioPlex
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.999997434
p_ni: 0.000002554
p_wrong: 1.2e-8
Score: 0.151
Data Source: BioPlex,STRINGDB
SUSD3
Tdark
Novelty: 1
p_int: 0.999877063
p_ni: 0.000011973
p_wrong: 0.000110964
Score: 0.211
Data Source: BioPlex,STRINGDB
PDE4DIP
Tbio
Novelty: 0.04181178
p_int: 0.999874966
p_ni: 0.000036523
p_wrong: 0.000088511
Score: 0.201
Data Source: BioPlex,STRINGDB
KLHL11
Tdark
Novelty: 0.39728266
p_int: 0.766509646
p_ni: 0.000032297
p_wrong: 0.233458056
Data Source: BioPlex
FCGR1A
Tchem
Novelty: 0.00091043
Score: 0.943
Data Source: STRINGDB
MRC1
Tbio
Novelty: 0.00137467
Score: 0.922
Data Source: STRINGDB
FCGR1B
Tbio
Novelty: 0.02624855
Score: 0.906
Data Source: STRINGDB
MRC2
Tbio
Novelty: 0.01533434
Score: 0.905
Data Source: STRINGDB
CD1C
Tbio
Novelty: 0.00092082
Score: 0.875
Data Source: STRINGDB
Publication Statistics
PubMed Score  272.63

PubMed score by year
PubTator Score  156.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGT
1-70
ISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQIL
70-140
TRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFS
140-210
LIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRF
210-280
WIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
280-328
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP