You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TBX20
T-box transcription factor TBX20

Protein Summary
Description
Acts as a transcriptional activator and repressor required for cardiac development and may have key roles in the maintenance of functional and structural phenotypes in adult heart. This gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box, and they are transcription factors involved in the regulation of developmental processes. This gene is essential for heart development. Mutations in this gene are associated with diverse cardiac pathologies, including defects in septation, valvulogenesis and cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000408931
  • ENSP00000386170
  • ENSG00000164532

Symbol
  • ASD4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.98
molecular function
0.9
PubMedID
0.61
histone modification site profile
0.6
kinase perturbation
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 68.48   (req: < 5)
Gene RIFs: 26   (req: <= 3)
Antibodies: 121   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 68.48   (req: >= 5)
Gene RIFs: 26   (req: > 3)
Antibodies: 121   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 36
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (27)
Items per page:
1 – 5 of 27
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Heart Development
WikiPathways
Heart Development
WikiPathways
Heart Development
WikiPathways
Heart Development
WikiPathways
Heart Development
Name
Explore in Pharos
Explore in Source
Heart Development
Heart Development
Heart Development
Heart Development
Heart Development
Gene Ontology Terms (38)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (68)
1 – 10 of 68
SLC25A21
Tbio
Family: Transporter
Novelty: 0.17991004
p_int: 0.999989585
p_ni: 0.000010384
p_wrong: 3.1e-8
Score: 0.859
Data Source: BioPlex,STRINGDB
BLVRA
Tbio
Family: Enzyme
Novelty: 0.00516694
p_int: 0.999897779
p_ni: 0.00010193
p_wrong: 2.91e-7
Score: 0.737
Data Source: BioPlex,STRINGDB
PHF13
Tbio
Family: Epigenetic
Novelty: 0.03638569
p_int: 0.999845766
p_ni: 0.000154234
Score: 0.86
Data Source: BioPlex,STRINGDB
TLE4
Tbio
Novelty: 0.02737837
p_int: 0.999673718
p_ni: 0.000326282
Score: 0.514
Data Source: BioPlex,STRINGDB
TBX18
Tbio
Family: TF
Novelty: 0.01534395
p_int: 0.999264334
p_ni: 9.34e-7
p_wrong: 0.000734732
Data Source: BioPlex
TLE3
Tbio
Novelty: 0.02798931
p_int: 0.993659315
p_ni: 0.006340685
Score: 0.493
Data Source: BioPlex,STRINGDB
TLE1
Tbio
Novelty: 0.00854022
p_int: 0.977071435
p_ni: 0.022928565
Score: 0.505
Data Source: BioPlex,STRINGDB
DNASE1L2
Tbio
Family: Enzyme
Novelty: 0.02115905
p_int: 0.917520436
p_ni: 0.082456498
p_wrong: 0.000023065
Score: 0.859
Data Source: BioPlex,STRINGDB
NKX2-5
Tbio
Family: TF
Novelty: 0.00147966
Score: 0.92
Data Source: STRINGDB
GATA4
Tbio
Family: TF
Novelty: 0.00115226
Score: 0.911
Data Source: STRINGDB
Publication Statistics
PubMed Score  68.48

PubMed score by year
PubTator Score  44.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDAHGEFGGG
1-70
SGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGV
70-140
DPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTN
140-210
NELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSN
210-280
PFAKGFRDSSRLTDIERESVESLIQKHSYARSPIRTYGGEEDVLGDESQTTPNRGSAFTTSDNLSLSSWV
280-350
SSSSSFPGFQHPQSLTALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGSGPTFPSFHMPR
350-420
YHHYFQQGPYAAIQGLRHSSAVMTPFV
420-447
MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQKHSYARSPIRTYGGEEDVLGDESQTTPNRGSAFTTSDNLSLSSWVSSSSSFPGFQHPQSLTALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGSGPTFPSFHMPRYHHYFQQGPYAAIQGLRHSSAVMTPFV