You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FAM161A
Protein FAM161A

Protein Summary
Description
Involved in ciliogenesis. This gene belongs to the FAM161 family. It is expressed mainly in the retina. Mouse studies suggested that this gene is involved in development of retinal progenitors during embryogenesis, and that its activity is restricted to mature photoreceptors after birth. Mutations in this gene cause autosomal recessive retinitis pigmentosa-28. Alternatively spliced transcript variants have been identified.[provided by RefSeq, Jan 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000404929
  • ENSP00000385158
  • ENSG00000170264
  • ENST00000405894
  • ENSP00000385893

Symbol
  • RP28
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
histone modification site profile
0.77
cellular component
0.71
transcription factor binding site profile
0.65
microRNA
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.13   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 73   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.13   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 73   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (15)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Protein-Protein Interactions (104)
1 – 10 of 104
LCA5
Tbio
Novelty: 0.05221608
Score: 0.858
Data Source: STRINGDB
CNGA1
Tchem
Family: IC
Novelty: 0.01215127
Score: 0.828
Data Source: STRINGDB
POC1B
Tbio
Novelty: 0.11982426
Score: 0.763
Data Source: STRINGDB
SDCCAG8
Tbio
Novelty: 0.06798507
Score: 0.722
Data Source: STRINGDB
CCDC65
Tdark
Novelty: 0.10161663
Score: 0.698
Data Source: STRINGDB
CERKL
Tbio
Family: Enzyme
Novelty: 0.0547283
Score: 0.683
Data Source: STRINGDB
SPEF2
Tdark
Novelty: 0.0493075
Score: 0.679
Data Source: STRINGDB
POU6F2
Tbio
Family: TF
Novelty: 0.03084244
Score: 0.677
Data Source: STRINGDB
DRC1
Tbio
Novelty: 0.50584913
Score: 0.673
Data Source: STRINGDB
ZNF513
Tbio
Family: TF
Novelty: 1.5
Score: 0.671
Data Source: STRINGDB
Publication Statistics
PubMed Score  15.13

PubMed score by year
PubTator Score  14.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATSHRVAKLVASSLQTPVNPITGARVAQYEREDPLKALAAAEAILEDEEEEKVAQPAGASADLNTSFSG
1-70
VDEHAPISYEDFVNFPDIHHSNEEYFKKVEELKAAHIETMAKLEKMYQDKLHLKEVQPVVIREDSLSDSS
70-140
RSVSEKNSYHPVSLMTSFSEPDLGQSSSLYVSSSEEELPNLEKEYPRKNRMMTYAKELINNMWTDFCVED
140-210
YIRCKDTGFHAAEKRRKKRKEWVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEYKK
210-280
KFRANPVPASVFLPLYHDLVKQKEERRRSLKEKSKEALLASQKPFKFIAREEQKRAAREKQLRDFLKYKK
280-350
KTNRFKARPIPRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKC
350-420
KHKVRCPTPDFEDLPERYQKHLSEHKSPKLLTVCKPFDLHASPHASIKREKILADIEADEENLKETRWPY
420-490
LSPRRKSPVRCAGVNPVPCNCNPPVPTVSSRGREQAVRKSEKERMREYQRELEEREEKLKKRPLLFERVA
490-560
QKNARMAAEKHYSNTLKALGISDEFVSKKGQSGKVLEYFNNQETKSVTEDKESFNEEEKIEERENGEENY
560-630
FIDTNSQDSYKEKDEANEESEEEKSVEESH
630-660
MATSHRVAKLVASSLQTPVNPITGARVAQYEREDPLKALAAAEAILEDEEEEKVAQPAGASADLNTSFSGVDEHAPISYEDFVNFPDIHHSNEEYFKKVEELKAAHIETMAKLEKMYQDKLHLKEVQPVVIREDSLSDSSRSVSEKNSYHPVSLMTSFSEPDLGQSSSLYVSSSEEELPNLEKEYPRKNRMMTYAKELINNMWTDFCVEDYIRCKDTGFHAAEKRRKKRKEWVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEYKKKFRANPVPASVFLPLYHDLVKQKEERRRSLKEKSKEALLASQKPFKFIAREEQKRAAREKQLRDFLKYKKKTNRFKARPIPRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKCKHKVRCPTPDFEDLPERYQKHLSEHKSPKLLTVCKPFDLHASPHASIKREKILADIEADEENLKETRWPYLSPRRKSPVRCAGVNPVPCNCNPPVPTVSSRGREQAVRKSEKERMREYQRELEEREEKLKKRPLLFERVAQKNARMAAEKHYSNTLKALGISDEFVSKKGQSGKVLEYFNNQETKSVTEDKESFNEEEKIEERENGEENYFIDTNSQDSYKEKDEANEESEEEKSVEESH