You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
C1S
Complement C1s subcomponent

Protein Summary
Description
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4. This gene encodes a serine protease, which is a major constituent of the human complement subcomponent C1. C1s associates with two other complement components C1r and C1q in order to yield the first component of the serum complement system. Defects in this gene are the cause of selective C1s deficiency. [provided by RefSeq, Mar 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000328916
  • ENSP00000328173
  • ENSG00000182326
  • ENST00000360817
  • ENSP00000354057
  • ENST00000406697
  • ENSP00000385035

Symbol
  • EDSPD2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
gene perturbation
0.76
PubMedID
0.67
small molecule perturbation
0.66
tissue
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 482.55   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 518   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 482.55   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 518   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 74
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
nafamostat
chemical structure image
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Classical antibody-mediated complement activation (R-HSA-173623)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Classical antibody-mediated complement activation
Reactome
Complement cascade
Reactome
Creation of C4 and C2 activators
Reactome
Immune System
Reactome
Initial triggering of complement
Name
Explore in Pharos
Explore in Source
Classical antibody-mediated complement activation
Complement cascade
Creation of C4 and C2 activators
Immune System
Initial triggering of complement
Protein-Protein Interactions (101)
1 – 10 of 101
C1R
Tclin
Novelty: 0.00294403
p_int: 0.999999446
p_ni: 3.03e-7
p_wrong: 2.51e-7
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
CCDC6
Tbio
Novelty: 0.01216915
p_int: 0.999998208
p_ni: 0.000001792
Score: 0.752
Data Source: BioPlex,STRINGDB
PPP4R1
Tbio
Family: Enzyme
Novelty: 0.14243726
p_int: 0.999763697
p_ni: 0.000236294
p_wrong: 1e-8
Score: 0.847
Data Source: BioPlex,STRINGDB
SERPING1
Tbio
Family: Enzyme
Novelty: 0.00076515
Score: 0.994
Data Source: Reactome,STRINGDB
C4A
Tbio
Novelty: 0.00075974
Score: 0.983
Data Source: Reactome,STRINGDB
C4B
Tbio
Novelty: 0.00094534
Score: 0.983
Data Source: Reactome,STRINGDB
C1QB
Tbio
Novelty: 0.01970194
Score: 0.972
Data Source: Reactome,STRINGDB
C1QA
Tbio
Novelty: 0.01665357
Score: 0.971
Data Source: Reactome,STRINGDB
C1QC
Tbio
Novelty: 0.04536303
Score: 0.97
Data Source: Reactome,STRINGDB
CRP
Tbio
Novelty: 0.0000246
Score: 0.938
Data Source: STRINGDB
Publication Statistics
PubMed Score  482.55

PubMed score by year
PubTator Score  488.61

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSV
1-70
QIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTGFAAYYVATDINECTDFVD
70-140
VPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEK
140-210
GFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQK
210-280
KGWKLRYHGDPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNS
280-350
KLKCQPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
350-420
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGNREPTMYVGST
420-490
SVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLM
490-560
DGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGEKGMDSCKG
560-630
DSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKNYVDWIMKTMQENSTPRED
630-688
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPKCVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGNREPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKNYVDWIMKTMQENSTPRED