You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ZFPM2
Zinc finger protein ZFPM2

Protein Summary
Description
Transcription regulator that plays a central role in heart morphogenesis and development of coronary vessels from epicardium, by regulating genes that are essential during cardiogenesis. Essential cofactor that acts via the formation of a heterodimer with transcription factors of the GATA family GATA4, GATA5 and GATA6. Such heterodimer can both activate or repress transcriptional activity, depending on the cell and promoter context. Also required in gonadal differentiation, possibly be regulating expression of SRY. Probably acts a corepressor of NR2F2 (By similarity). The zinc finger protein encoded by this gene is a widely expressed member of the FOG family of transcription factors. The family members modulate the activity of GATA family proteins, which are important regulators of hematopoiesis and cardiogenesis in mammals. It has been demonstrated that the protein can both activate and down-regulate expression of GATA-target genes, suggesting different modulation in different promote ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000407775
  • ENSP00000384179
  • ENSG00000169946

Symbol
  • FOG2
  • ZNF89B
  • DIH3
  • FOG2
  • SRXY9
  • ZNF89B
  • hFOG-2
  • ZC2HC11B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.99
molecular function
0.91
biological process
0.88
PubMedID
0.84
phenotype
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 71.47   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 129   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 71.47   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 129   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 26
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Factors involved in megakaryocyte development and platelet production (R-HSA-983231)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Factors involved in megakaryocyte development and platelet production
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Factors involved in megakaryocyte development and platelet production
Hemostasis
Gene Ontology Terms (29)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Non-traceable Author Statement (NAS)
BHF-UCL
Non-traceable Author Statement (NAS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (55)
1 – 10 of 55
GATA4
Tbio
Family: TF
Novelty: 0.00115226
Score: 0.992
Data Source: STRINGDB
GATA1
Tbio
Family: TF
Novelty: 0.0009412
Score: 0.968
Data Source: STRINGDB
GATA2
Tbio
Family: TF
Novelty: 0.00178271
Score: 0.963
Data Source: STRINGDB
GATA6
Tbio
Family: TF
Novelty: 0.00338656
Score: 0.962
Data Source: STRINGDB
GATA3
Tbio
Family: TF
Novelty: 0.00087325
Score: 0.958
Data Source: STRINGDB
GATA5
Tbio
Family: TF
Novelty: 0.0101933
Score: 0.946
Data Source: STRINGDB
ZFPM1
Tbio
Family: TF
Novelty: 0.00277855
Score: 0.916
Data Source: STRINGDB
AMH
Tbio
Novelty: 0.0003157
Score: 0.688
Data Source: STRINGDB
CTBP1
Tbio
Novelty: 0.00313629
Score: 0.636
Data Source: STRINGDB
WT1
Tbio
Family: TF
Novelty: 0.00042049
Score: 0.62
Data Source: STRINGDB
Publication Statistics
PubMed Score  71.47

PubMed score by year
PubTator Score  43.62

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEVEYFCNKGDDE
1-70
GIQETAESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQLPVGTTWGPFPGKMDLNNNSL
70-140
KTKAQVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQLWCTTTKAISEGEELIAFVVDFDSRLQAAS
140-210
QMTLTEGMYPARLLDSIQLLPQQAAMASILPTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREA
210-280
APVSEENEDSAHQISSLCPFPQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINF
280-350
HQHLFSHLTQAAFRCNHCHFGFQTQRELLQHQELHVPSGKLPRESDMEHSPSATEDSLQPATDLLTRSEL
350-420
PQSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLASSPVQPNIGP
420-490
SFPVGPFLSQFSFPQDITMVPQASEILAKMSELVHRRLRHGSSSYPPVIYSPLMPKGATCFECNITFNNL
490-560
DNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTGQTSINLLNPAAHSADPENPLLQTSCINSST
560-630
VLDLIGPNGKGHDKDFSTQTKKLSTSSNNDDKINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHE
630-700
TYMVHKQYYCATRHDPPLKRSASNKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLVQQRFLDVANLNNPC
700-770
TSTQEPTEGLGECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQS
770-840
ERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKVFPNPESERNSPDVSYE
840-910
RSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRHLFLPQCLYPGAIKKAKGADQ
910-980
LSPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQASSNGCAALKKDSLPLLPKNRGMVIVNGGLKQ
980-1050
DERPAANPQQENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKY
1050-1120
CRLCDIQFNNLSNFITHKKFYCSSHAAEHVK
1120-1151
MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEVEYFCNKGDDEGIQETAESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQLPVGTTWGPFPGKMDLNNNSLKTKAQVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQLWCTTTKAISEGEELIAFVVDFDSRLQAASQMTLTEGMYPARLLDSIQLLPQQAAMASILPTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREAAPVSEENEDSAHQISSLCPFPQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINFHQHLFSHLTQAAFRCNHCHFGFQTQRELLQHQELHVPSGKLPRESDMEHSPSATEDSLQPATDLLTRSELPQSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLASSPVQPNIGPSFPVGPFLSQFSFPQDITMVPQASEILAKMSELVHRRLRHGSSSYPPVIYSPLMPKGATCFECNITFNNLDNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTGQTSINLLNPAAHSADPENPLLQTSCINSSTVLDLIGPNGKGHDKDFSTQTKKLSTSSNNDDKINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHETYMVHKQYYCATRHDPPLKRSASNKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLVQQRFLDVANLNNPCTSTQEPTEGLGECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQSERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKVFPNPESERNSPDVSYERSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRHLFLPQCLYPGAIKKAKGADQLSPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQASSNGCAALKKDSLPLLPKNRGMVIVNGGLKQDERPAANPQQENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKYCRLCDIQFNNLSNFITHKKFYCSSHAAEHVK