You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PLA2G2A
Phospholipase A2, membrane associated

Protein Summary
Description
Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides (PubMed:2925633). Thought to participate in the regulation of phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Independent of its catalytic activity, acts as a ligand for integrins (PubMed:18635536, PubMed:25398877). Binds to and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 (PubMed:18635536, PubMed:25398877). Binds to a site (site 2) which is distinct from the classical ligand-binding site (site 1) and induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:25398877). Induces cell proliferation in an integrin-dependent manner (PubMed:18635536). The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375111
  • ENSP00000364252
  • ENSG00000188257
  • ENST00000400520
  • ENSP00000383364

Symbol
  • PLA2B
  • PLA2L
  • RASF-A
  • MOM1
  • PLA2
  • PLA2B
  • PLA2L
  • PLA2S
  • PLAS1
  • sPLA2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.92
biological process
0.87
disease
0.84
metabolite
0.8
small molecule perturbation
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 801.99   (req: < 5)
Gene RIFs: 150   (req: <= 3)
Antibodies: 232   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 801.99   (req: >= 5)
Gene RIFs: 150   (req: > 3)
Antibodies: 232   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 154
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (18)
1 – 5 of 18
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (31)
Acyl chain remodelling of PC (R-HSA-1482788)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acyl chain remodelling of PC
Reactome
Acyl chain remodelling of PE
Reactome
Acyl chain remodelling of PG
Reactome
Acyl chain remodelling of PI
Reactome
Acyl chain remodelling of PS
Name
Explore in Pharos
Explore in Source
Acyl chain remodelling of PC
Acyl chain remodelling of PE
Acyl chain remodelling of PG
Acyl chain remodelling of PI
Acyl chain remodelling of PS
Gene Ontology Terms (30)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (116)
1 – 10 of 116
GPC1
Tbio
Novelty: 0.00384835
Score: 0.917
Data Source: STRINGDB
PLA2G7
Tchem
Family: Enzyme
Novelty: 0.00370934
Score: 0.879
Data Source: STRINGDB
PLA2G6
Tchem
Family: Enzyme
Novelty: 0.00258089
Score: 0.876
Data Source: STRINGDB
PLA2R1
Tbio
Family: Enzyme
Novelty: 0.00550393
Score: 0.869
Data Source: STRINGDB
ALOX12
Tchem
Family: Enzyme
Novelty: 0.00425715
Score: 0.856
Data Source: STRINGDB
PLA2G16
Tbio
Novelty: 0.00826239
Score: 0.851
Data Source: STRINGDB
PTGS2
Tclin
Family: Enzyme
Novelty: 0.00008134
Score: 0.851
Data Source: STRINGDB
ALOX5
Tclin
Family: Enzyme
Novelty: 0.00071056
Score: 0.839
Data Source: STRINGDB
ALOX15
Tchem
Family: Enzyme
Novelty: 0.00222058
Score: 0.838
Data Source: STRINGDB
PLA2G15
Tbio
Family: Enzyme
Novelty: 0.01771583
Score: 0.835
Data Source: STRINGDB
Publication Statistics
PubMed Score  801.99

PubMed score by year
PubTator Score  896.95

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCC
1-70
YKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGS
70-140
TPRC
140-144
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC