You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GGT1
Glutathione hydrolase 1 proenzyme

Protein Summary
Description
Cleaves the gamma-glutamyl bond of extracellular glutathione (gamma-Glu-Cys-Gly), glutathione conjugates, and other gamma-glutamyl compounds. The metabolism of glutathione releases free glutamate and the dipeptide cysteinyl-glycine, which is hydrolyzed to cysteine and glycine by dipeptidases. In the presence of high concentrations of dipeptides and some amino acids, can also catalyze a transpeptidation reaction, transferring the gamma-glutamyl moiety to an acceptor amino acid to form a new gamma-glutamyl compound. Initiates extracellular glutathione (GSH) breakdown, provides cells with a local cysteine supply and contributes to maintain intracellular GSH level. It is part of the cell antioxidant defense mechanism. Isoform 3 seems to be inactive. The enzyme encoded by this gene is a type I gamma-glutamyltransferase that catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light cha ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000248923
  • ENSP00000248923
  • ENSG00000100031
  • ENST00000400380
  • ENSP00000383231
  • ENST00000400382
  • ENSP00000383232
  • ENST00000401885
  • ENSP00000384381
  • ENST00000403838
  • ENSP00000384820
  • ENST00000404532
  • ENSP00000385445
  • ENST00000425895
  • ENSP00000387499

Symbol
  • GGT
  • GGT
  • GTG
  • GGTD
  • CD224
  • GGT 1
  • D22S672
  • D22S732
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.97
chemical
0.85
PubMedID
0.84
transcription factor perturbation
0.8
disease
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1298.5   (req: < 5)
Gene RIFs: 135   (req: <= 3)
Antibodies: 424   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1298.5   (req: >= 5)
Gene RIFs: 135   (req: > 3)
Antibodies: 424   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (28)
Aflatoxin activation and detoxification (R-HSA-5423646)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Aflatoxin activation and detoxification
Reactome
Arachidonic acid metabolism
Reactome
Biological oxidations
Reactome
Defective GGT1 causes Glutathionuria (GLUTH)
Reactome
Disease
Name
Explore in Pharos
Explore in Source
Aflatoxin activation and detoxification
Arachidonic acid metabolism
Biological oxidations
Defective GGT1 causes Glutathionuria (GLUTH)
Disease
Gene Ontology Terms (28)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (223)
1 – 10 of 223
GGT3P
Tdark
Family: Enzyme
p_int: 0.999854775
p_ni: 1.1e-8
p_wrong: 0.000145214
Data Source: BioPlex
GGCT
Tchem
Family: Enzyme
Novelty: 0.0017048
Score: 0.984
Data Source: STRINGDB
GSR
Tclin
Family: Enzyme
Novelty: 0.00057594
Score: 0.951
Data Source: STRINGDB
GCLC
Tchem
Family: Enzyme
Novelty: 0.0028376
Score: 0.948
Data Source: STRINGDB
GSS
Tbio
Family: Enzyme
Novelty: 0.00180721
Score: 0.946
Data Source: STRINGDB
GLS
Tchem
Family: Enzyme
Novelty: 0.00104556
Score: 0.943
Data Source: STRINGDB
OPLAH
Tbio
Family: Enzyme
Novelty: 0.02787364
Score: 0.94
Data Source: STRINGDB
ANPEP
Tchem
Family: Enzyme
Novelty: 0.00051458
Score: 0.937
Data Source: STRINGDB
GCLM
Tbio
Family: Enzyme
Novelty: 0.00530445
Score: 0.931
Data Source: STRINGDB
GAD1
Tbio
Family: Enzyme
Novelty: 0.00102125
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  1298.50

PubMed score by year
PubTator Score  413.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIA
1-70
ALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRG
70-140
YELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTL
140-210
PQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAP
210-280
LSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFF
280-350
AAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNE
350-420
MDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLW
420-490
FGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDS
490-560
RKGGEPAGY
560-569
MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY