You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
USP25
Ubiquitin carboxyl-terminal hydrolase 25

Protein Classes
Protein Summary
Description
Deubiquitinating enzyme that hydrolyzes ubiquitin moieties conjugated to substrates and thus, functions to process newly synthesized Ubiquitin, to recycle ubiquitin molecules or to edit polyubiquitin chains and prevents proteasomal degradation of substrates. Hydrolyzes both 'Lys-48'- and 'Lys-63'-linked tetraubiquitin chains. The muscle-specific isoform (USP25m) may have a role in the regulation of muscular differentiation and function. Ubiquitin (MIM 191339) is a highly conserved 76-amino acid protein involved in regulation of intracellular protein breakdown, cell cycle regulation, and stress response. Ubiquitin is released from degraded proteins by disassembly of the polyubiquitin chains, which is mediated by ubiquitin-specific proteases (USPs), such as USP25 (Valero et al., 1999 [PubMed 10644437]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000285679
  • ENSP00000285679
  • ENSG00000155313
  • ENST00000285681
  • ENSP00000285681
  • ENST00000400183
  • ENSP00000383044

Symbol
  • USP21
  • USP21
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
disease perturbation
0.95
cell line
0.79
microRNA
0.77
protein domain
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.38   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 219   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.38   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 219   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Deubiquitination (R-HSA-5688426)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Deubiquitination
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Ub-specific processing proteases
Name
Explore in Pharos
Explore in Source
Deubiquitination
Metabolism of proteins
Post-translational protein modification
Ub-specific processing proteases
Gene Ontology Terms (19)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Non-traceable Author Statement (NAS)
ParkinsonsUK-UCL
Non-traceable Author Statement (NAS)
ParkinsonsUK-UCL
Protein-Protein Interactions (132)
1 – 10 of 132
GDI1
Tbio
Novelty: 0.02210681
p_int: 0.999999767
p_ni: 2.33e-7
Score: 0.167
Data Source: BioPlex,STRINGDB
DCUN1D2
Tdark
Novelty: 1.25874126
p_int: 0.999927703
p_ni: 0.000072297
p_wrong: 1e-9
Score: 0.289
Data Source: BioPlex,STRINGDB
KCTD13
Tbio
Novelty: 0.11075463
p_int: 0.999793371
p_ni: 0.000206532
p_wrong: 9.7e-8
Score: 0.812
Data Source: BioPlex,STRINGDB
TNFAIP1
Tbio
Novelty: 0.04871082
p_int: 0.999682922
p_ni: 0.000316705
p_wrong: 3.73e-7
Score: 0.817
Data Source: BioPlex,STRINGDB
CYP2J2
Tchem
Novelty: 0.00634057
p_int: 0.999382772
p_ni: 0.000617228
Data Source: BioPlex
RAD23B
Tbio
Novelty: 0.00958222
p_int: 0.999279743
p_ni: 0.000720257
Score: 0.873
Data Source: BioPlex,STRINGDB
BTBD9
Tbio
Novelty: 0.04603076
p_int: 0.999065242
p_ni: 0.000934758
Score: 0.544
Data Source: BioPlex,STRINGDB
PYY
Tbio
Novelty: 0.0007798
p_int: 0.997299766
p_ni: 0.002700179
p_wrong: 5.5e-8
Data Source: BioPlex
UBB
Tbio
Novelty: 0.00895161
p_int: 0.996586816
p_ni: 0.003413184
Score: 0.431
Data Source: BioPlex,STRINGDB
USP28
Tbio
Family: Enzyme
Novelty: 0.01515344
p_int: 0.996377649
p_ni: 0.003622351
Score: 0.236
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  32.38

PubMed score by year
PubTator Score  21.73

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAKTPQQEETTYY
1-70
QTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRETGITDEEQAISRVLEASIAEN
70-140
KACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYKPPSNAQDLP
140-210
RNQKEHRNLPFMRELRYLFALLVGTKRKYVDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQM
210-280
KAEEETDEEKPKNPMVELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLH
280-350
SENSGKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIK
350-420
RLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPPSGSIPSQTLPST
420-490
TEQQGALSSELPSTSPSSVAAISSRSVIHKPFTQSRIPPDLPMHPAPRHITEEELSVLESCLHRWRTEIE
490-560
NDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHEGQANAGHYWAYIFDHRESRWMKYNDIAVTK
560-630
SSWEELVRDSFGGYRNASAYCLMYINDKAQFLIQEEFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKEL
630-700
EEWDAQLAQKALQEKLLASQKLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIQIITKASHEHED
700-770
KSPETVLQSAIKLEYARLVKLAQEDTPPETDYRLHHVVVYFIQNQAPKKIIEKTLLEQFGDRNLSFDERC
770-840
HNIMKVAQAKLEMIKPEEVNLEEYEEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQNNKEL
840-910
LSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNEFIVPFLPLLLVDEMEEKDIL
910-980
AVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIKSFHEPPKLPSYSTHELCERFARIMLSLSRT
980-1050
PADGR
1050-1055
MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAKTPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRETGITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYVDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIKRLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPPSGSIPSQTLPSTTEQQGALSSELPSTSPSSVAAISSRSVIHKPFTQSRIPPDLPMHPAPRHITEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHEGQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDKAQFLIQEEFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQKLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIQIITKASHEHEDKSPETVLQSAIKLEYARLVKLAQEDTPPETDYRLHHVVVYFIQNQAPKKIIEKTLLEQFGDRNLSFDERCHNIMKVAQAKLEMIKPEEVNLEEYEEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQNNKELLSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNEFIVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIKSFHEPPKLPSYSTHELCERFARIMLSLSRTPADGR