You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CLDN8
Claudin-8

Protein Summary
Description
Tight-junction protein required for paracellular chloride transport in the kidney. Mediates recruitment of CLDN4 to tight junction in the kidney. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This protein plays important roles in the paracellular cation barrier of the distal renal tubule, and in the paracellular barrier to prevent sodium back-leakage in distal colon. Differential expression of this gene has been observed in colorectal carcinoma and renal cell tumors, and along with claudin-7, is an i ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000399899
  • ENSP00000382783
  • ENSG00000156284

Symbol
  • HEL-S-79
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.92
microRNA
0.66
protein domain
0.58
tissue sample
0.5
cell line
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 30.91   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 240   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 30.91   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 240   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Cell junction organization (R-HSA-446728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell junction organization
Reactome
Cell-Cell communication
Reactome
Cell-cell junction organization
Reactome
Tight junction interactions
Name
Explore in Pharos
Explore in Source
Cell junction organization
Cell-Cell communication
Cell-cell junction organization
Tight junction interactions
Gene Ontology Terms (9)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (43)
1 – 10 of 43
CLDN12
Tbio
Novelty: 0.06470623
Score: 0.979
Data Source: STRINGDB
CLDN16
Tbio
Novelty: 0.0103486
Score: 0.926
Data Source: STRINGDB
CLDN23
Tbio
Novelty: 0.16372511
Score: 0.919
Data Source: STRINGDB
CLDN11
Tbio
Novelty: 0.00250727
Score: 0.913
Data Source: STRINGDB
CLDN15
Tbio
Novelty: 0.03927388
Score: 0.912
Data Source: STRINGDB
CLDN4
Tbio
Novelty: 0.00107983
Score: 0.912
Data Source: STRINGDB
CLDN2
Tbio
Novelty: 0.00319519
Score: 0.912
Data Source: STRINGDB
CLDN3
Tbio
Novelty: 0.00374279
Score: 0.911
Data Source: STRINGDB
CLDN7
Tbio
Novelty: 0.00860191
Score: 0.911
Data Source: STRINGDB
CLDN10
Tbio
Novelty: 0.02850566
Score: 0.911
Data Source: STRINGDB
Publication Statistics
PubMed Score  30.91

PubMed score by year
PubTator Score  29.49

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSL
1-70
LALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWV
70-140
ANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYH
140-210
TGKKSPSVYSRSQYV
210-225
MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWVANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV