You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RPRD1A
Regulation of nuclear pre-mRNA domain-containing protein 1A

Protein Summary
Description
Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD by RPAP2. May act as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle. This gene encodes a cell-cycle and transcription regulatory protein. The encoded protein interacts with the cell cycle inhibitor cyclin-dependent kinase 4 inhibitor B and may function as a negative regulator of G(1)/S phase progression. This protein also forms homo- and hetrodimers with the protein, regulation of nuclear pre-mRNA domain-containing protein 1B, to form a scaffold that interacts with the C-terminal domain of RNA polymerase II subunit B1 and regulates several aspects of transcription. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 16. [provided by RefSeq, Dec 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357384
  • ENSP00000349955
  • ENSG00000141425
  • ENST00000399022
  • ENSP00000381984
  • ENST00000588737
  • ENSP00000465444
  • ENST00000590898
  • ENSP00000467991

Symbol
  • P15RS
  • P15RS
  • HsT3101
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.99
microRNA
0.78
kinase perturbation
0.71
histone modification site profile
0.68
tissue sample
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.71   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 104   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.71   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 104   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
RNA Polymerase II Transcription
Reactome
RNA polymerase II transcribes snRNA genes
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
RNA Polymerase II Transcription
RNA polymerase II transcribes snRNA genes
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Protein-Protein Interactions (146)
1 – 10 of 146
RPRD1B
Tbio
Novelty: 0.00917211
p_int: 1
Score: 0.98
Data Source: BioPlex,Reactome,STRINGDB
POLR2G
Tbio
Family: Enzyme
Novelty: 0.01513348
p_int: 0.999971083
p_ni: 0.000028915
p_wrong: 2e-9
Score: 0.981
Data Source: BioPlex,STRINGDB
LMO2
Tbio
Novelty: 0.00508219
p_int: 0.999969421
p_ni: 0.000030579
Score: 0.515
Data Source: BioPlex,STRINGDB
POLR2J
Tbio
Family: Enzyme
Novelty: 0.03501746
p_int: 0.999905892
p_ni: 0.000094108
p_wrong: 1e-9
Score: 0.901
Data Source: BioPlex,STRINGDB
POLR2M
Tbio
Family: Enzyme
Novelty: 0.10421601
p_int: 0.999860672
p_ni: 0.000139327
p_wrong: 1e-9
Score: 0.767
Data Source: BioPlex,STRINGDB
POLR2D
Tdark
Family: Enzyme
Novelty: 0.27988338
p_int: 0.999026448
p_ni: 0.000973542
p_wrong: 1e-8
Score: 0.98
Data Source: BioPlex,STRINGDB
ASB6
Tdark
Novelty: 0.47244094
p_int: 0.992818238
p_ni: 0.00717952
p_wrong: 0.000002242
Score: 0.798
Data Source: BioPlex,STRINGDB
FAM9B
Tdark
Novelty: 0.75
p_int: 0.982794697
p_ni: 0.017205303
Data Source: BioPlex
GPN1
Tbio
Family: Enzyme
Novelty: 0.08558329
p_int: 0.972686884
p_ni: 0.027221397
p_wrong: 0.000091719
Data Source: BioPlex
SNRNP27
Tbio
Novelty: 0.00944493
p_int: 0.963363994
p_ni: 0.036635835
p_wrong: 1.71e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  9.71

PubMed score by year
PubTator Score  3.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNS
1-70
KRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTY
70-140
EQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGE
140-210
RLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELR
210-280
SRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED
280-312
MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRSRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED