You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
CCDC33
Coiled-coil domain-containing protein 33

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000268082
  • ENSP00000268082
  • ENSG00000140481
  • ENST00000321374
  • ENSP00000325661
  • ENST00000398814
  • ENSP00000381795
  • ENST00000558821
  • ENSP00000452817

Symbol
  • CT61
  • HP11097
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor
0.61
cell type or tissue
0.57
cell line
0.54
hub protein
0.44
chemical
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.78   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 50   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.78   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 50   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (39)
1 – 10 of 39
CENPF
Tbio
Novelty: 0.00870005
p_int: 0.999999126
p_ni: 8.74e-7
Score: 0.188
Data Source: BioPlex,STRINGDB
UBASH3B
Tbio
Novelty: 0.01852629
p_int: 0.999996288
p_ni: 0.000003703
p_wrong: 9e-9
Score: 0.282
Data Source: BioPlex,STRINGDB
ADAMTS4
Tchem
Family: Enzyme
Novelty: 0.00578587
p_int: 0.999944877
p_ni: 0.000055123
Score: 0.182
Data Source: BioPlex,STRINGDB
PRMT5
Tchem
Family: Epigenetic
Novelty: 0.00494231
p_int: 0.880377187
p_ni: 0.119622813
Score: 0.188
Data Source: BioPlex,STRINGDB
UBE2O
Tbio
Novelty: 0.07223942
p_int: 0.805705875
p_ni: 0.194294124
p_wrong: 1e-9
Score: 0.185
Data Source: BioPlex,STRINGDB
UBL7
Tdark
Novelty: 0.30057803
Score: 0.78
Data Source: STRINGDB
ZER1
Tbio
Novelty: 0.05686147
Score: 0.744
Data Source: STRINGDB
GRAMD2A
Tbio
Novelty: 0.71794872
Score: 0.742
Data Source: STRINGDB
DCAF12
Tbio
Novelty: 0.09567198
Score: 0.716
Data Source: STRINGDB
SEMA7A
Tbio
Novelty: 0.00800866
Score: 0.666
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.78

PubMed score by year
PubTator Score  2.16

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAFRGPEPWVSASLLRQRLKAEEKTLDLEFEVLSVGFNEAGRYALRLSAENPLQVGSGAGVQLQVNDGDP
1-70
FPACSAITDVIEQQEPGQSLTLTRSKFIFTLPKGFCKNDGQHDAQLHVEALRLDEPLGRAAQRVGEAIFP
70-140
IYPRPDQPRMNPKAQDHEDLYRYCGNLALLRASTDPTARHCGSLAYSVAFHVHRGPQPPVSDSPPRAGQP
140-210
ELMSPEEPLIASQSTEPEIGHLSPSKKETIMVTLHGATNLPACKDGSEPWPYVVVKSTSEEKNNQSSKAV
210-280
TSVTSEPTRAPIWGDTVNVEIQAEDAGQEDVILKVVDNRKKQELLSYKIPIKYLRVFHPYHFELVKPTES
280-350
GKADEATAKTQLYATVVRKSSFIPRYIGCNHMALEIFLRGVNEPLANNPNPIVVIARVVPNYKEFKVSQA
350-420
NRDLASVGLPITPLSFPIPSMMNFDVPRVSQNGCPQLSKPGGPPEQPLWNQSFLFQGRDGATSFSEDTAL
420-490
VLEYYSSTSMKGSQPWTLNQPLGISVLPLKSRLYQKMLTGKGLDGLHVERLPIMDTSLKTINDEAPTVAL
490-560
SFQLLSSERPENFLTPNNSKALPTLDPKILDKKLRTIQESWSKDTVSSTMDLSTSTPREAEEEPLVPEMS
560-630
HDTEMNNYRRAMQKMAEDILSLRRQASILEGENRILRSRLAQQEEEEGQGKASEAQNTVSMKQKLLLSEL
630-700
DMKKLRDRVQHLQNELIRKNDREKELLLLYQAQQPQAALLKQYQGKLQKMKALEETVRHQEKVIEKMERV
700-770
LEDRLQDRSKPPPLNRQQGKPYTGFPMLSASGLPLGSMGENLPVELYSVLLAENAKLRTELDKNRHQQAP
770-840
IILQQQALPDLLSGTSDKFNLLAKLEHAQSRILSLESQLEDSARRWGREKQDLATRLQEQEKGFRHPSNS
840-910
IIIEQPSALTHSMDLKQPSELEPLLPSSDSKLNKPLSPQKETANSQQT
910-958
MAFRGPEPWVSASLLRQRLKAEEKTLDLEFEVLSVGFNEAGRYALRLSAENPLQVGSGAGVQLQVNDGDPFPACSAITDVIEQQEPGQSLTLTRSKFIFTLPKGFCKNDGQHDAQLHVEALRLDEPLGRAAQRVGEAIFPIYPRPDQPRMNPKAQDHEDLYRYCGNLALLRASTDPTARHCGSLAYSVAFHVHRGPQPPVSDSPPRAGQPELMSPEEPLIASQSTEPEIGHLSPSKKETIMVTLHGATNLPACKDGSEPWPYVVVKSTSEEKNNQSSKAVTSVTSEPTRAPIWGDTVNVEIQAEDAGQEDVILKVVDNRKKQELLSYKIPIKYLRVFHPYHFELVKPTESGKADEATAKTQLYATVVRKSSFIPRYIGCNHMALEIFLRGVNEPLANNPNPIVVIARVVPNYKEFKVSQANRDLASVGLPITPLSFPIPSMMNFDVPRVSQNGCPQLSKPGGPPEQPLWNQSFLFQGRDGATSFSEDTALVLEYYSSTSMKGSQPWTLNQPLGISVLPLKSRLYQKMLTGKGLDGLHVERLPIMDTSLKTINDEAPTVALSFQLLSSERPENFLTPNNSKALPTLDPKILDKKLRTIQESWSKDTVSSTMDLSTSTPREAEEEPLVPEMSHDTEMNNYRRAMQKMAEDILSLRRQASILEGENRILRSRLAQQEEEEGQGKASEAQNTVSMKQKLLLSELDMKKLRDRVQHLQNELIRKNDREKELLLLYQAQQPQAALLKQYQGKLQKMKALEETVRHQEKVIEKMERVLEDRLQDRSKPPPLNRQQGKPYTGFPMLSASGLPLGSMGENLPVELYSVLLAENAKLRTELDKNRHQQAPIILQQQALPDLLSGTSDKFNLLAKLEHAQSRILSLESQLEDSARRWGREKQDLATRLQEQEKGFRHPSNSIIIEQPSALTHSMDLKQPSELEPLLPSSDSKLNKPLSPQKETANSQQT