You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
TNFSF11
Tumor necrosis factor ligand superfamily member 11

Protein Summary
Description
Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (PubMed:22664871). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts. During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper os ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000239849
  • ENSP00000239849
  • ENSG00000120659
  • ENST00000358545
  • ENSP00000351347
  • ENST00000398795
  • ENSP00000381775
  • ENST00000405262
  • ENSP00000384042
  • ENST00000544862
  • ENSP00000444913

Symbol
  • OPGL
  • RANKL
  • TRANCE
  • ODF
  • OPGL
  • sOdf
  • CD254
  • OPTB2
  • RANKL
  • TNLG6B
  • TRANCE
  • hRANKL2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
0.88
PubMedID
0.87
gene perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4698.57   (req: < 5)
Gene RIFs: 541   (req: <= 3)
Antibodies: 1061   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4698.57   (req: >= 5)
Gene RIFs: 541   (req: > 3)
Antibodies: 1061   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 38
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
denosumab
no chemical structure image available
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (38)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Reactome
TNFR2 non-canonical NF-kB pathway
Reactome
TNFs bind their physiological receptors
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
Protein-Protein Interactions (354)
1 – 10 of 354
GOSR1
Tbio
Novelty: 0.04353116
p_int: 0.999999102
p_ni: 8.98e-7
Score: 0.243
Data Source: BioPlex,STRINGDB
ATP5MC1
Tbio
Family: Enzyme
Novelty: 0.05848632
p_int: 0.988026321
p_ni: 0.011973653
p_wrong: 2.6e-8
Score: 0.332
Data Source: BioPlex,STRINGDB
DNAJB9
Tbio
Novelty: 0.00792417
p_int: 0.91282664
p_ni: 0.087172247
p_wrong: 0.000001112
Score: 0.158
Data Source: BioPlex,STRINGDB
MT-ND1
Tclin
Family: Enzyme
Novelty: 0.00152131
p_int: 0.90702908
p_ni: 0.061025184
p_wrong: 0.031945737
Score: 0.187
Data Source: BioPlex,STRINGDB
TNFRSF11B
Tbio
Novelty: 0.00046043
Score: 0.999
Data Source: Reactome,STRINGDB
TNFRSF11A
Tbio
Novelty: 0.00076198
Score: 0.998
Data Source: Reactome,STRINGDB
TRAF6
Tbio
Novelty: 0.00159491
Score: 0.989
Data Source: STRINGDB
FOS
Tbio
Family: TF
Novelty: 0.00007002
Score: 0.983
Data Source: STRINGDB
TNFRSF1B
Tbio
Novelty: 0.00019286
Score: 0.968
Data Source: STRINGDB
TNFSF12
Tbio
Novelty: 0.00304205
Score: 0.968
Data Source: STRINGDB
Publication Statistics
PubMed Score  4698.57

PubMed score by year
PubTator Score  2365.34

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYF
1-70
RAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHI
70-140
RAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQ
140-210
DGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGF
210-280
FKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
280-317
MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID