You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
GSTP1
Glutathione S-transferase P

Protein Summary
Description
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000398606
  • ENSP00000381607
  • ENSG00000084207
  • ENST00000642444
  • ENSP00000493538

Symbol
  • FAEES3
  • GST3
  • PI
  • DFN7
  • GST3
  • GSTP
  • FAEES3
  • HEL-S-22
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
1
transcription factor perturbation
0.99
biological process
0.97
disease perturbation
0.97
cell type or tissue
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1876.44   (req: < 5)
Gene RIFs: 863   (req: <= 3)
Antibodies: 735   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1876.44   (req: >= 5)
Gene RIFs: 863   (req: > 3)
Antibodies: 735   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 52
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 34
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (64)
1 – 5 of 64
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Detoxification of Reactive Oxygen Species
Reactome
Glutathione conjugation
Name
Explore in Pharos
Explore in Source
Biological oxidations
Cellular responses to external stimuli
Cellular responses to stress
Detoxification of Reactive Oxygen Species
Glutathione conjugation
Gene Ontology Terms (64)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Non-traceable Author Statement (NAS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (195)
1 – 10 of 195
PRDX6
Tbio
Novelty: 0.00188945
Score: 0.967
Data Source: Reactome,STRINGDB
EPHX1
Tchem
Family: Enzyme
Novelty: 0.00210581
Score: 0.94
Data Source: STRINGDB
GSTT2B
Tbio
Family: Enzyme
Novelty: 0.02896495
Score: 0.923
Data Source: STRINGDB
GGH
Tchem
Family: Enzyme
Novelty: 0.00341456
Score: 0.914
Data Source: STRINGDB
CYP1A1
Tchem
Novelty: 0.00028982
Score: 0.908
Data Source: STRINGDB
GSTO1
Tchem
Family: Enzyme
Novelty: 0.00873007
Score: 0.897
Data Source: STRINGDB
GSTO2
Tbio
Family: Enzyme
Novelty: 0.02293247
Score: 0.889
Data Source: STRINGDB
CYP2E1
Tchem
Novelty: 0.00037342
Score: 0.886
Data Source: STRINGDB
CYP1B1
Tchem
Novelty: 0.00109729
Score: 0.885
Data Source: STRINGDB
TRAF2
Tbio
Novelty: 0.01051586
Score: 0.878
Data Source: STRINGDB
Publication Statistics
PubMed Score  1876.44

PubMed score by year
PubTator Score  1454.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTIL
1-70
RHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGG
70-140
KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
140-210
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ