Protein Summary
As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virt ...more
- ENST00000376925
- ENSP00000366124
- ENSG00000101439
- ENST00000398409
- ENSP00000381446
- ENST00000398411
- ENSP00000381448
- ARMD11
- HEL-S-2
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
biological term | 1 | ||
PubMedID | 0.98 | ||
disease perturbation | 0.9 | ||
kinase perturbation | 0.88 | ||
gene perturbation | 0.78 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 3600.66 (req: < 5)
Gene RIFs: 430 (req: <= 3)
Antibodies: 1243 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 3600.66 (req: >= 5)
Gene RIFs: 430 (req: > 3)
Antibodies: 1243 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 17
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (69)
Reactome (8)
KEGG (1)
WikiPathways (60)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 8
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Amyloid fiber formation | ||||
Reactome | Immune System | ||||
Reactome | Innate Immune System | ||||
Reactome | Metabolism of proteins | ||||
Reactome | Neutrophil degranulation | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Amyloid fiber formation | ||||
Immune System | ||||
Innate Immune System | ||||
Metabolism of proteins | ||||
Neutrophil degranulation | ||||
Gene Ontology Terms (23)
Functions (5)
Components (6)
Processes (12)
Items per page:
10
1 – 5 of 5
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | BHF-UCL | |||
Inferred from Physical Interaction (IPI) | IntAct | |||
Inferred from Physical Interaction (IPI) | BHF-UCL | |||
Protein-Protein Interactions (235)
1 – 10 of 235
DDX31
Family: Enzyme
Novelty: 4
p_int: 0.950121091
p_ni: 0.049878896
p_wrong: 1.2e-8
Score: 0.189
Data Source: BioPlex,STRINGDB
CSTB
Novelty: 0.00153055
Score: 0.979
Data Source: STRINGDB
ALB
Novelty: 0.0000092
Score: 0.978
Data Source: STRINGDB
B2M
Novelty: 0.00012184
Score: 0.973
Data Source: STRINGDB
CTSD
Family: Enzyme
Novelty: 0.0003299
Score: 0.972
Data Source: STRINGDB
CTSS
Family: Enzyme
Novelty: 0.00788672
Score: 0.96
Data Source: STRINGDB
APOE
Novelty: 0.0000621
Score: 0.959
Data Source: STRINGDB
IL6
Novelty: 0.00002829
Score: 0.956
Data Source: STRINGDB
APP
Novelty: 0.00011446
Score: 0.956
Data Source: STRINGDB
CTSH
Family: Enzyme
Novelty: 0.00380318
Score: 0.955
Data Source: STRINGDB
Publication Statistics
PubMed Score 3600.66
PubMed score by year
PubTator Score 3557.03
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHS
1-70
RALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSK
70-140
STCQDA
140-146
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Find similar targets by: