You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NPS
Neuropeptide S

Protein Summary
Description
Modulates arousal and anxiety. May play an important anorexigenic role (By similarity). Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations (PubMed:15312648, PubMed:16790440).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000398023
  • ENSP00000381105
  • ENSG00000214285
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
pathway
0.52
transcription factor
0.49
disease
0.47
phenotype
0.43
chemical
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7407.25   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 127   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7407.25   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 127   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (20)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
G alpha (s) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (448)
1 – 10 of 448
TAC1
Tbio
Novelty: 0.00007711
Score: 0.992
Data Source: STRINGDB
CALCA
Tclin
Novelty: 0.00012558
Score: 0.991
Data Source: STRINGDB
CALCA
Tbio
Novelty: 0.00012558
Score: 0.991
Data Source: STRINGDB
POMC
Tbio
Novelty: 0.00002654
Score: 0.988
Data Source: STRINGDB
VIP
Tbio
Novelty: 0.00028207
Score: 0.988
Data Source: STRINGDB
OXT
Tbio
Novelty: 0.00006195
Score: 0.986
Data Source: STRINGDB
HCRT
Tbio
Novelty: 0.00044523
Score: 0.986
Data Source: STRINGDB
CCK
Tbio
Novelty: 0.00013779
Score: 0.985
Data Source: STRINGDB
CRH
Tbio
Novelty: 0.00017805
Score: 0.985
Data Source: STRINGDB
NTS
Tbio
Novelty: 0.00035891
Score: 0.984
Data Source: STRINGDB
Publication Statistics
PubMed Score  7407.25

PubMed score by year
PubTator Score  50.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRS
1-70
FRNGVGTGMKKTSFQRAKS
70-89
MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS