You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NFIX
Nuclear factor 1 X-type

Protein Summary
Description
Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. The protein encoded by this gene is a transcription factor that binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3 in viral and cellular promoters. The encoded protein can also stimulate adenovirus replication in vitro. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000397661
  • ENSP00000380781
  • ENSG00000008441
  • ENST00000585575
  • ENSP00000468794
  • ENST00000587260
  • ENSP00000467785
  • ENST00000587760
  • ENSP00000466389
  • ENST00000592199
  • ENSP00000467512

Symbol
  • CTF
  • NF1A
  • NF1-X
  • MRSHSS
  • NF-I/X
  • SOTOS2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.95
transcription factor perturbation
0.91
disease perturbation
0.74
protein domain
0.73
biological process
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 82.1   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 118   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 82.1   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 118   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
RNA Polymerase III Abortive And Retractive Initiation
Reactome
RNA Polymerase III Transcription
Reactome
RNA Polymerase III Transcription Termination
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
RNA Polymerase III Abortive And Retractive Initiation
RNA Polymerase III Transcription
RNA Polymerase III Transcription Termination
Gene Ontology Terms (9)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (41)
1 – 10 of 41
NFIB
Tbio
Family: TF
Novelty: 0.00861711
p_int: 0.999998384
p_wrong: 0.000001616
Score: 0.704
Data Source: BioPlex,STRINGDB
POLR3G
Tbio
Family: Enzyme
Novelty: 0.058744
Score: 0.907
Data Source: STRINGDB
POLR3D
Tbio
Family: Enzyme
Novelty: 0.03502574
Score: 0.904
Data Source: STRINGDB
POLR1D
Tbio
Family: Enzyme
Novelty: 0.02859451
Score: 0.9
Data Source: STRINGDB
POLR3C
Tbio
Family: Enzyme
Novelty: 0.1416566
Score: 0.9
Data Source: STRINGDB
POLR3A
Tbio
Family: Enzyme
Novelty: 0.00525546
Score: 0.9
Data Source: STRINGDB
POLR3E
Tbio
Family: Enzyme
Novelty: 0.00736648
Score: 0.9
Data Source: STRINGDB
POLR3GL
Tbio
Family: Enzyme
Novelty: 0.03131524
Score: 0.9
Data Source: STRINGDB
CRCP
Tbio
Family: Enzyme
Novelty: 0.01140443
Score: 0.9
Data Source: STRINGDB
POLR2H
Tbio
Family: Enzyme
Novelty: 0.06263034
Score: 0.9
Data Source: STRINGDB
Publication Statistics
PubMed Score  82.10

PubMed score by year
PubTator Score  49.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEIKQK
1-70
WASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGI
70-140
PLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLAYFVHTPESGQSDSSNQQGDADIKPLPNGHL
140-210
SFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKS
210-280
IDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHP
280-350
LPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQPN
350-420
GSGQGKVPGSFLLPPPPPVARPVPLPMPDSKSTSTAPDGAALTPPSPSFATTGASSANRFVSIGPRDGNF
420-490
LNIPQQSQSWFL
490-502
MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLAYFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQPNGSGQGKVPGSFLLPPPPPVARPVPLPMPDSKSTSTAPDGAALTPPSPSFATTGASSANRFVSIGPRDGNFLNIPQQSQSWFL