You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
INS
Insulin

Protein Classes
Protein Summary
Description
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2019]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000250971
  • ENSP00000250971
  • ENSG00000254647
  • ENST00000381330
  • ENSP00000370731
  • ENST00000397262
  • ENSP00000380432

Symbol
  • IDDM
  • ILPR
  • IRDN
  • IDDM1
  • IDDM2
  • MODY10
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
1
phenotype
0.76
disease perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 155642.44   (req: < 5)
Gene RIFs: 666   (req: <= 3)
Antibodies: 3206   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 155642.44   (req: >= 5)
Gene RIFs: 666   (req: > 3)
Antibodies: 3206   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 68
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (266)
1 – 5 of 266
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (99)
Amyloid fiber formation (R-HSA-977225)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 34
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amyloid fiber formation
Reactome
Asparagine N-linked glycosylation
Reactome
COPI-mediated anterograde transport
Reactome
Developmental Biology
Reactome
ER to Golgi Anterograde Transport
Name
Explore in Pharos
Explore in Source
Amyloid fiber formation
Asparagine N-linked glycosylation
COPI-mediated anterograde transport
Developmental Biology
ER to Golgi Anterograde Transport
Protein-Protein Interactions (1651)
1 – 10 of 1651
UBR2
Tbio
Family: Enzyme
Novelty: 0.03319944
p_int: 0.997933351
p_ni: 0.002066649
Data Source: BioPlex
SEMA3C
Tbio
Novelty: 0.00902769
p_int: 0.991541059
p_ni: 0.008273882
p_wrong: 0.000185059
Score: 0.212
Data Source: BioPlex,STRINGDB
COL14A1
Tbio
Novelty: 0.00758642
p_int: 0.990133439
p_ni: 0.00986656
p_wrong: 2e-9
Score: 0.166
Data Source: BioPlex,STRINGDB
PXYLP1
Tbio
Family: Enzyme
Novelty: 0.00920316
p_int: 0.976147025
p_ni: 0.023591093
p_wrong: 0.000261882
Data Source: BioPlex
SULF2
Tbio
Family: Enzyme
Novelty: 0.01443436
p_int: 0.97231979
p_ni: 0.027680091
p_wrong: 1.19e-7
Score: 0.524
Data Source: BioPlex,STRINGDB
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.96774504
p_ni: 0.03225496
Score: 0.587
Data Source: BioPlex,STRINGDB
UBR1
Tbio
Family: Enzyme
Novelty: 0.00742688
p_int: 0.946314856
p_ni: 0.053685144
Data Source: BioPlex
CHST10
Tbio
Family: Enzyme
Novelty: 0.06875665
p_int: 0.941505825
p_ni: 0.058492797
p_wrong: 0.000001378
Data Source: BioPlex
PRSS12
Tbio
Novelty: 0.03177005
p_int: 0.921444542
p_ni: 0.000040009
p_wrong: 0.078515449
Data Source: BioPlex
ERAP1
Tchem
Family: Enzyme
Novelty: 0.00447092
p_int: 0.906928059
p_ni: 0.093071941
Score: 0.315
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  155642.44

PubMed score by year
PubTator Score  62986.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG
1-70
GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
70-110
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN