You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
USP8
Ubiquitin carboxyl-terminal hydrolase 8

Protein Summary
Description
Hydrolase that can remove conjugated ubiquitin from proteins and therefore plays an important regulatory role at the level of protein turnover by preventing degradation. Converts both 'Lys-48' an 'Lys-63'-linked ubiquitin chains. Catalytic activity is enhanced in the M phase. Involved in cell proliferation. Required to enter into S phase in response to serum stimulation. May regulate T-cell anergy mediated by RNF128 via the formation of a complex containing RNF128 and OTUB1. Probably regulates the stability of STAM2 and RASGRF1. Regulates endosomal ubiquitin dynamics, cargo sorting, membrane traffic at early endosomes, and maintenance of ESCRT-0 stability. The level of protein ubiquitination on endosomes is essential for maintaining the morphology of the organelle. Deubiquitinates EPS15 and controles tyrosine kinase stability. Removes conjugated ubiquitin from EGFR thus regulating EGFR degradation and downstream MAPK signaling. Involved in acrosome biogenesis through interaction with t ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000307179
  • ENSP00000302239
  • ENSG00000138592
  • ENST00000396444
  • ENSP00000379721
  • ENST00000425032
  • ENSP00000412682

Symbol
  • KIAA0055
  • UBPY
  • UBPY
  • PITA4
  • SPG59
  • HumORF8
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
interacting protein
0.85
histone modification site profile
0.79
cellular component
0.78
transcription factor binding site profile
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 71.16   (req: < 5)
Gene RIFs: 51   (req: <= 3)
Antibodies: 252   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 71.16   (req: >= 5)
Gene RIFs: 51   (req: > 3)
Antibodies: 252   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (20)
Deubiquitination (R-HSA-5688426)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Deubiquitination
Reactome
Downregulation of ERBB2 signaling
Reactome
Downregulation of ERBB2:ERBB3 signaling
Reactome
Metabolism of proteins
Reactome
Negative regulation of MET activity
Name
Explore in Pharos
Explore in Source
Deubiquitination
Downregulation of ERBB2 signaling
Downregulation of ERBB2:ERBB3 signaling
Metabolism of proteins
Negative regulation of MET activity
Protein-Protein Interactions (169)
1 – 10 of 169
GRAP2
Tbio
Novelty: 0.00186531
p_int: 1
Score: 0.554
Data Source: BioPlex,STRINGDB
CD83
Tbio
Novelty: 0.00171116
p_int: 0.994232288
p_ni: 0.005767532
p_wrong: 1.8e-7
Score: 0.2
Data Source: BioPlex,STRINGDB
ACTRT1
Tdark
Novelty: 0.8
p_int: 0.934108675
p_ni: 0.007393216
p_wrong: 0.058498109
Data Source: BioPlex
RNF41
Tbio
Family: Enzyme
Novelty: 0.02458297
Score: 0.997
Data Source: Reactome,STRINGDB
STAM2
Tbio
Novelty: 0.05576208
Score: 0.982
Data Source: Reactome,STRINGDB
EGFR
Tclin
Family: Kinase
Novelty: 0.0000974
Score: 0.981
Data Source: STRINGDB
OTUB1
Tbio
Family: Enzyme
Novelty: 0.01650041
Score: 0.98
Data Source: Reactome,STRINGDB
RNF128
Tbio
Family: Enzyme
Novelty: 0.03254465
Score: 0.98
Data Source: Reactome,STRINGDB
UBC
Tbio
Novelty: 0.00161137
Score: 0.976
Data Source: STRINGDB
HGS
Tbio
Family: Enzyme
Novelty: 0.00097717
Score: 0.97
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  71.16

PubMed score by year
PubTator Score  52.06

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVY
1-70
NLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQE
70-140
TGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDY
140-210
QDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDA
210-280
LFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQ
280-350
TPPASIEVDENIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEE
350-420
HRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEKELRERQQEEQ
420-490
KEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKETSAKRGKEITGVKRQSKSEHE
490-560
TSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGKPFKIKGQPESGILRTGTFREDTDDTERNK
560-630
AQREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKP
630-700
QIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFG
700-770
GSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG
770-840
QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA
840-910
WQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDN
910-980
NRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKK
980-1050
YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT
1050-1118
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEEHRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEKELRERQQEEQKEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKETSAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGKPFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT