You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACBD5
Acyl-CoA-binding domain-containing protein 5

Protein Summary
Description
Acyl-CoA binding protein which acts as the peroxisome receptor for pexophagy but is dispensable for aggrephagy and nonselective autophagy. Binds medium- and long-chain acyl-CoA esters. This gene encodes a member of the acyl-Coenzyme A binding protein family, known to function in the transport and distribution of long chain acyl-Coenzyme A in cells. This gene may play a role in the differentiation of megakaryocytes and formation of platelets. A related protein in yeast is involved in autophagy of peroxisomes. A mutation in this gene has been associated with autosomal dominant thrombocytopenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375888
  • ENSP00000365049
  • ENSG00000107897
  • ENST00000375901
  • ENSP00000365066
  • ENST00000375905
  • ENSP00000365070
  • ENST00000396271
  • ENSP00000379568

Symbol
  • KIAA1996
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.99
transcription factor binding site profile
0.9
histone modification site profile
0.81
transcription factor perturbation
0.61
cell type or tissue
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.32   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 109   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.32   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 109   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Class I peroxisomal membrane protein import (R-HSA-9603798)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class I peroxisomal membrane protein import
Reactome
Fatty acid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Peroxisomal lipid metabolism
Name
Explore in Pharos
Explore in Source
Class I peroxisomal membrane protein import
Fatty acid metabolism
Metabolism
Metabolism of lipids
Peroxisomal lipid metabolism
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (38)
1 – 10 of 38
VAPB
Tbio
Novelty: 0.00566042
p_int: 0.999999994
p_ni: 3e-9
p_wrong: 3e-9
Score: 0.782
Data Source: BioPlex,STRINGDB
CNGA3
Tchem
Family: IC
Novelty: 0.00973676
p_int: 0.999999987
p_ni: 1e-9
p_wrong: 1.2e-8
Score: 0.272
Data Source: BioPlex,STRINGDB
VAPA
Tbio
Novelty: 0.0022428
p_int: 0.999999981
p_ni: 1.8e-8
p_wrong: 1e-9
Score: 0.754
Data Source: BioPlex,STRINGDB
ZFPL1
Tbio
Novelty: 0.06292606
p_int: 0.999825521
p_ni: 0.000173764
p_wrong: 7.15e-7
Score: 0.547
Data Source: BioPlex,STRINGDB
NECAB2
Tbio
Novelty: 0.23965763
p_int: 0.999823036
p_ni: 0.000176964
Score: 0.213
Data Source: BioPlex,STRINGDB
ACBD7
Tdark
Novelty: 1.13055182
Score: 0.737
Data Source: STRINGDB
HINT3
Tdark
Novelty: 1.875
Score: 0.676
Data Source: STRINGDB
PEX19
Tbio
Novelty: 0.00469515
Score: 0.594
Data Source: STRINGDB
SLC25A17
Tbio
Family: Transporter
Novelty: 0.00694201
Score: 0.567
Data Source: STRINGDB
ANKRD26
Tbio
Novelty: 0.0200273
Score: 0.561
Data Source: STRINGDB
Publication Statistics
PubMed Score  8.32

PubMed score by year
PubTator Score  9.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFQFHAGSWESWCCCCLIPADRPWDRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLK
1-70
FYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRV
70-140
IGPFYEIVEDKKSGRSSDITSVRLEKISKCLEDLGNVLTSTPNAKTVNGKAESSDSGAESEEEEAQEEVK
140-210
GAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSA
210-280
VCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPMENSGF
280-350
REDIQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEG
350-420
TKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTSTLQTAPQ
420-490
PTSQRPSWWPFEMSPGVLTFAIIWPFIAQWLVYLYYQRRRRKLN
490-534
MFQFHAGSWESWCCCCLIPADRPWDRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDITSVRLEKISKCLEDLGNVLTSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTSTLQTAPQPTSQRPSWWPFEMSPGVLTFAIIWPFIAQWLVYLYYQRRRRKLN