You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CCK
Cholecystokinin

Protein Summary
Description
This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000334681
  • ENSP00000335657
  • ENSG00000187094
  • ENST00000396169
  • ENSP00000379472
  • ENST00000434608
  • ENSP00000409124
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.96
biological process
0.89
biological term
0.76
chemical
0.62
disease
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7794.38   (req: < 5)
Gene RIFs: 72   (req: <= 3)
Antibodies: 255   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7794.38   (req: >= 5)
Gene RIFs: 72   (req: > 3)
Antibodies: 255   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (25)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Protein-Protein Interactions (355)
1 – 10 of 355
TRIM68
Tbio
Family: Enzyme
Novelty: 0.27820711
p_int: 0.999948611
p_ni: 0.000051374
p_wrong: 1.5e-8
Data Source: BioPlex
CCKBR
Tclin
Family: GPCR
Novelty: 0.00166746
Score: 0.998
Data Source: Reactome,STRINGDB
CCKAR
Tclin
Family: GPCR
Novelty: 0.00159237
Score: 0.997
Data Source: Reactome,STRINGDB
GAST
Tbio
Novelty: 0.00012434
Score: 0.992
Data Source: STRINGDB
GRP
Tbio
Novelty: 0.00039263
Score: 0.989
Data Source: STRINGDB
GCG
Tchem
Novelty: 0.00005614
Score: 0.986
Data Source: STRINGDB
TAC1
Tbio
Novelty: 0.00007711
Score: 0.986
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.985
Data Source: STRINGDB
NTS
Tbio
Novelty: 0.00035891
Score: 0.985
Data Source: STRINGDB
OXT
Tbio
Novelty: 0.00006195
Score: 0.983
Data Source: STRINGDB
Publication Statistics
PubMed Score  7794.38

PubMed score by year
PubTator Score  2299.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQAR
1-70
KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
70-115
MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS