You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CASP5
Caspase-5

Protein Summary
Description
Mediator of programmed cell death (apoptosis). During non-canonical inflammasome activation, cuts CGAS and may play a role in the regulation of antiviral innate immune activation (PubMed:28314590). This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript varian ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260315
  • ENSP00000260315
  • ENSG00000137757
  • ENST00000393141
  • ENSP00000376849
  • ENST00000418434
  • ENSP00000398130
  • ENST00000444749
  • ENSP00000388365
  • ENST00000456200
  • ENSP00000408455
  • ENST00000526056
  • ENSP00000436877
  • ENST00000531367
  • ENSP00000434471

Symbol
  • ICH3
  • ICH-3
  • ICEREL-III
  • ICE(rel)III
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.99
virus perturbation
0.88
cell type or tissue
0.85
biological process
0.6
cell line
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 101.14   (req: < 5)
Gene RIFs: 29   (req: <= 3)
Antibodies: 515   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 101.14   (req: >= 5)
Gene RIFs: 29   (req: > 3)
Antibodies: 515   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 20
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (71)
1 – 10 of 71
CASP4
Tchem
Family: Enzyme
Novelty: 0.00576072
p_int: 0.999999847
p_ni: 5e-9
p_wrong: 1.48e-7
Score: 0.893
Data Source: BioPlex,STRINGDB
ARHGAP44
Tbio
Family: Enzyme
Novelty: 0.02469338
p_int: 0.992134868
p_ni: 0.000478228
p_wrong: 0.007386904
Score: 0.345
Data Source: BioPlex,STRINGDB
LACRT
Tbio
Novelty: 0.04444288
p_int: 0.916240649
p_ni: 0.076839055
p_wrong: 0.006920296
Score: 0.189
Data Source: BioPlex,STRINGDB
NLRP1
Tbio
Novelty: 0.00548
Score: 0.987
Data Source: STRINGDB
PYCARD
Tbio
Novelty: 0.00561282
Score: 0.979
Data Source: STRINGDB
NLRP3
Tchem
Novelty: 0.00042021
Score: 0.976
Data Source: STRINGDB
CARD8
Tbio
Family: Enzyme
Novelty: 0.00962965
Score: 0.97
Data Source: STRINGDB
AIM2
Tbio
Novelty: 0.00325294
Score: 0.965
Data Source: STRINGDB
GSDMD
Tbio
Novelty: 0.01231428
Score: 0.942
Data Source: STRINGDB
CASP1
Tchem
Family: Enzyme
Novelty: 0.00043112
Score: 0.936
Data Source: STRINGDB
Publication Statistics
PubMed Score  101.14

PubMed score by year
PubTator Score  125.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVK
1-70
MLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLRKNRVAHQMFTQTLLNMDQKI
70-140
TSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHDEIYPIKKREDRRRLALIICNTKFDHLPARN
140-210
GAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKK
210-280
KKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCK
280-350
IHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIE
350-420
RATLTRDFYLFPGN
420-434
MAEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLRKNRVAHQMFTQTLLNMDQKITSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHDEIYPIKKREDRRRLALIICNTKFDHLPARNGAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKKKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIERATLTRDFYLFPGN