You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CYREN
Cell cycle regulator of non-homologous end joining

Protein Summary
Description
Isoform 1: Cell-cycle-specific inhibitor of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair during the S and G2 phases (PubMed:28959974). Acts as a regulator of DNA repair pathway choice by specifically inhibiting classical NHEJ during the S and G2 phases, thereby promoting error-free repair by homologous recombination during cell cycle phases when sister chromatids are present (PubMed:28959974). Preferentially protects single-stranded overhangs at break sites by inhibiting classical NHEJ, thereby creating a local environment that favors homologous recombination (PubMed:28959974). Acts via interaction with XRCC5/Ku80 and XRCC6/Ku70, interaction restricted during the S and G2 phases only (PubMed:28959974). Molecular mechanisms governing classical NHEJ inhibition via interaction with XRCC5/Ku80 and XRCC6/Ku70 are unknown (PubMed:28959974). May act as a regulator of proteasome (By similarity). Isoform 4: Cell-cycle-specific inhibitor of classical non-ho ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000393114
  • ENSP00000376823
  • ENSG00000122783
  • ENST00000424142
  • ENSP00000400024
  • ENST00000483029
  • ENSP00000473365
  • ENST00000617987
  • ENSP00000480430
  • ENST00000620897
  • ENSP00000481014

Symbol
  • C7orf49
  • MRI
  • MRI
  • MRI-2
  • C7orf49
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 149   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 45   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 149   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 45   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (21)
1 – 10 of 21
MRI1
Tbio
Family: Enzyme
Novelty: 0.00421775
Score: 0.921
Data Source: STRINGDB
GUCA2A
Tbio
Novelty: 0.00916459
Score: 0.718
Data Source: STRINGDB
TRPV6
Tchem
Family: IC
Novelty: 0.00369085
Score: 0.714
Data Source: STRINGDB
AMHR2
Tbio
Family: Kinase
Novelty: 0.00697119
Score: 0.712
Data Source: STRINGDB
PRKG2
Tchem
Family: Kinase
Novelty: 0.01736783
Score: 0.646
Data Source: STRINGDB
CTNND2
Tbio
Novelty: 0.0153174
Score: 0.626
Data Source: STRINGDB
METTL13
Tbio
Family: Enzyme
Novelty: 0.00156588
Score: 0.616
Data Source: STRINGDB
PHF5A
Tbio
Family: Epigenetic
Novelty: 0.00307327
Score: 0.582
Data Source: STRINGDB
ERVK-10
Tdark
Novelty: 1.42857143
Score: 0.576
Data Source: STRINGDB
COL10A1
Tbio
Novelty: 0.00697565
Score: 0.571
Data Source: STRINGDB
Publication Statistics
PubMed Score  149.00

PubMed score by year
PubTator Score  2392.49

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILI
1-70
ESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPE
70-140
EEEEEDVLKYVREIFFS
140-157
METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS