You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZNF493
Zinc finger protein 493

Protein Summary
Description
May be involved in transcriptional regulation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000339914
  • ENSP00000340651
  • ENSG00000196268
  • ENST00000355504
  • ENSP00000347691
  • ENST00000392288
  • ENSP00000376110
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.58
cell line
0.57
transcription factor
0.57
histone modification site profile
0.53
microRNA
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.89   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 59   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.89   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 59   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
Protein-Protein Interactions (9)
1 – 9 of 9
TRIM28
Tbio
Family: Epigenetic
Novelty: 0.01042773
Score: 0.917
Data Source: STRINGDB
CENPH
Tbio
Novelty: 0.03525011
Score: 0.795
Data Source: STRINGDB
SLC43A3
Tdark
Family: Transporter
Novelty: 0.24793388
Score: 0.559
Data Source: STRINGDB
AJAP1
Tbio
Novelty: 0.05123776
Score: 0.474
Data Source: STRINGDB
LMO3
Tbio
Novelty: 0.04749768
Score: 0.466
Data Source: STRINGDB
PIEZO1
Tchem
Family: IC
Novelty: 0.00589781
Score: 0.443
Data Source: STRINGDB
GALNT7
Tbio
Family: Enzyme
Novelty: 0.07335574
Score: 0.44
Data Source: STRINGDB
CDK12
Tchem
Family: Kinase
Novelty: 0.02400161
Score: 0.407
Data Source: STRINGDB
SLC19A1
Tchem
Family: Transporter
Novelty: 0.00690808
Score: 0.405
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.89

PubMed score by year
PubTator Score  0.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNECNVHKEGYNELNQYLTTTQSKIFQCDKYVKVFHKLLNSNRHNTKHTGKKPFKCKKCGKSFCMLLHLC
1-70
QHKRIHIRENSYRCEECGKAFIWFSTLTRHRRVHTGEKSYKYECGKSFNQDSNLTTHKRIHTGQKPYKCE
70-140
ECGTSFYQFSYLTRHKLIHTREKPYKCEQYGKTFNQSSTLTGHKIIHNGEKPYKCEECGKAFSIFSTPTK
140-210
HKIIHTEEKSHRCEEYCKAYKESSHLTTHKRIHTGEKPYKCEECGKAFSIFSTLTKHKIIHTEEKSHRCE
210-280
ECGKAYKESSHLTTHKRIHTGEKPYKCEECGKTFSVFSILTKHKIIHTEEKPYKCEECGKAFKRSSTLTK
280-350
HRIIHTEEKPYKCEECGKAFNQSSTLSIHKIIHTGEKPYKCEECGKAFKRSSTLTIHKMIHTGEKPYKCE
350-420
ECGKAFNRSSHLTTHKRIHTGHKPYKCKECGKSFSVFSTLTKHKIIHTDKKPYKCEECGKAFNRSSILSI
420-490
HKKIHTGEKPYKCEECGKAFKRSSHLAGHKQIHSVQKPYKCEECGKAFSIFSTLTKHKIIHTEEKPYKCE
490-560
KCGKTFYRFSNLNTHKIIHTGEKPCKCEECGKAFNHSSNLIKHKLIHTGDKPYKCEACGKAFRRSSHLSR
560-630
HKIIHIGIHTEETVQK
630-646
MNECNVHKEGYNELNQYLTTTQSKIFQCDKYVKVFHKLLNSNRHNTKHTGKKPFKCKKCGKSFCMLLHLCQHKRIHIRENSYRCEECGKAFIWFSTLTRHRRVHTGEKSYKYECGKSFNQDSNLTTHKRIHTGQKPYKCEECGTSFYQFSYLTRHKLIHTREKPYKCEQYGKTFNQSSTLTGHKIIHNGEKPYKCEECGKAFSIFSTPTKHKIIHTEEKSHRCEEYCKAYKESSHLTTHKRIHTGEKPYKCEECGKAFSIFSTLTKHKIIHTEEKSHRCEECGKAYKESSHLTTHKRIHTGEKPYKCEECGKTFSVFSILTKHKIIHTEEKPYKCEECGKAFKRSSTLTKHRIIHTEEKPYKCEECGKAFNQSSTLSIHKIIHTGEKPYKCEECGKAFKRSSTLTIHKMIHTGEKPYKCEECGKAFNRSSHLTTHKRIHTGHKPYKCKECGKSFSVFSTLTKHKIIHTDKKPYKCEECGKAFNRSSILSIHKKIHTGEKPYKCEECGKAFKRSSHLAGHKQIHSVQKPYKCEECGKAFSIFSTLTKHKIIHTEEKPYKCEKCGKTFYRFSNLNTHKIIHTGEKPCKCEECGKAFNHSSNLIKHKLIHTGDKPYKCEACGKAFRRSSHLSRHKIIHIGIHTEETVQK