You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZNF566
Zinc finger protein 566

Protein Summary
Description
May be involved in transcriptional regulation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000392170
  • ENSP00000376010
  • ENSG00000186017
  • ENST00000424129
  • ENSP00000401259
  • ENST00000434377
  • ENSP00000415520
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.92
transcription factor binding site profile
0.92
transcription factor
0.81
microRNA
0.76
cell type or tissue
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.1   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 102   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.1   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 102   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
Protein-Protein Interactions (7)
1 – 7 of 7
SPATA20
Tdark
Novelty: 0.34285714
p_int: 0.999409178
p_wrong: 0.000590822
Score: 0.26
Data Source: BioPlex,STRINGDB
TRIM28
Tbio
Family: Epigenetic
Novelty: 0.01042773
Score: 0.903
Data Source: STRINGDB
ZNF608
Tdark
Novelty: 0.23863984
Score: 0.575
Data Source: STRINGDB
ZNF804A
Tbio
Novelty: 0.00890297
Score: 0.511
Data Source: STRINGDB
TSNAX
Tbio
Novelty: 0.01408734
Score: 0.428
Data Source: STRINGDB
ABHD14B
Tdark
Family: Enzyme
Novelty: 0.71794872
Score: 0.412
Data Source: STRINGDB
POLE4
Tdark
Family: Enzyme
Novelty: 0.30757964
Score: 0.412
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.10

PubMed score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQESVMFSDVSVDFSQEEWECLNDDQRDLYRDVMLENYSNLVSMGHSISKPNVISYLEQGKEPWLADRE
1-70
LTRGQWPVLESRCETKKLFLKKEIYEIESTQWEIMEKLTRRDFQCSSFRDDWECNRQFKKELGSQGGHFN
70-140
QLVFTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEIIHTIEKPYECKECGKSFRH
140-210
PSRLTHHQKIHTGKKPFECKECGKTFICGSDLTRHHRIHTGEKPYECKECGKAFSSGSNFTRHQRIHTGE
210-280
KPYECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRIHTGEKPYECKECEKAFRS
280-350
GSDLTRHQRIHTGEKPYECKICGKAYSQSSQLISHHRIHTSEKPYEYRECGKNFNYDPQLIQHQNLYW
350-418
MAQESVMFSDVSVDFSQEEWECLNDDQRDLYRDVMLENYSNLVSMGHSISKPNVISYLEQGKEPWLADRELTRGQWPVLESRCETKKLFLKKEIYEIESTQWEIMEKLTRRDFQCSSFRDDWECNRQFKKELGSQGGHFNQLVFTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEIIHTIEKPYECKECGKSFRHPSRLTHHQKIHTGKKPFECKECGKTFICGSDLTRHHRIHTGEKPYECKECGKAFSSGSNFTRHQRIHTGEKPYECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRIHTGEKPYECKECEKAFRSGSDLTRHQRIHTGEKPYECKICGKAYSQSSQLISHHRIHTSEKPYEYRECGKNFNYDPQLIQHQNLYW