You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ALPP
Alkaline phosphatase, placental type

Protein Classes
Protein Summary
Description
The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. The protein is primarily expressed in placental and endometrial tissue; however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells. [provided by RefSeq, Jan 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000392027
  • ENSP00000375881
  • ENSG00000163283

Symbol
  • PLAP
  • ALP
  • IAP
  • ALPI
  • PALP
  • PLAP
  • PLAP-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.68
gene perturbation
0.67
protein domain
0.58
biological term
0.56
cellular component
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 751.62   (req: < 5)
Gene RIFs: 36   (req: <= 3)
Antibodies: 1497   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 751.62   (req: >= 5)
Gene RIFs: 36   (req: > 3)
Antibodies: 1497   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Intra-Golgi and retrograde Golgi-to-ER traffic (R-HSA-6811442)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Intra-Golgi and retrograde Golgi-to-ER traffic
Reactome
Intra-Golgi traffic
Reactome
Membrane Trafficking
Reactome
Vesicle-mediated transport
Name
Explore in Pharos
Explore in Source
Intra-Golgi and retrograde Golgi-to-ER traffic
Intra-Golgi traffic
Membrane Trafficking
Vesicle-mediated transport
Gene Ontology Terms (7)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (81)
1 – 10 of 81
ALPG
Tchem
Family: Enzyme
Novelty: 0.00264445
p_int: 1
Score: 0.873
Data Source: BioPlex,STRINGDB
ALPI
Tbio
Family: Enzyme
Novelty: 0.00247141
p_int: 0.999999547
p_ni: 4.53e-7
Score: 0.855
Data Source: BioPlex,STRINGDB
PTS
Tbio
Family: Enzyme
Novelty: 0.00144771
Score: 0.913
Data Source: STRINGDB
GCH1
Tbio
Family: Enzyme
Novelty: 0.00149919
Score: 0.91
Data Source: STRINGDB
NTPCR
Tbio
Family: Enzyme
Novelty: 0.05949008
Score: 0.908
Data Source: STRINGDB
TPK1
Tbio
Family: Kinase
Novelty: 0.018697
Score: 0.901
Data Source: STRINGDB
TRIP11
Tbio
Novelty: 0.0357761
Score: 0.9
Data Source: STRINGDB
ARF1
Tchem
Family: Enzyme
Novelty: 0.00272021
Score: 0.9
Data Source: STRINGDB
GGT7
Tbio
Family: Enzyme
Novelty: 0.0180475
Score: 0.713
Data Source: STRINGDB
GGT6
Tbio
Family: Enzyme
Novelty: 0.02156029
Score: 0.697
Data Source: STRINGDB
Publication Statistics
PubMed Score  751.62

PubMed score by year
PubTator Score  3633.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVST
1-70
VTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARF
70-140
NQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIAT
140-210
QLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASL
210-280
DPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRAL
280-350
TETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG
350-420
YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACL
420-490
EPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP
490-535
MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP