You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ERCC2
General transcription and DNA repair factor IIH helicase subunit XPD

Protein Summary
Description
ATP-dependent 5'-3' DNA helicase, component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. The ATP-dependent helicase activity of XPD/ERCC2 is required for DNA opening. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. XPD/ERCC2 acts by forming a bridge between CAK and the core-TFIIH complex. Involved in the regulation of vitamin-D receptor acti ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000391945
  • ENSP00000375809
  • ENSG00000104884
  • ENST00000485403
  • ENSP00000431229

Symbol
  • XPD
  • XPDC
  • EM9
  • TTD
  • XPD
  • TTD1
  • COFS2
  • TFIIH
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
biological process
0.99
biological term
0.99
protein domain
0.99
disease perturbation
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 355.45   (req: < 5)
Gene RIFs: 450   (req: <= 3)
Antibodies: 250   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 355.45   (req: >= 5)
Gene RIFs: 450   (req: > 3)
Antibodies: 250   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 54
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (58)
Cytosolic iron-sulfur cluster assembly (R-HSA-2564830)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 49
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytosolic iron-sulfur cluster assembly
Reactome
DNA Repair
Reactome
Disease
Reactome
Dual Incision in GG-NER
Reactome
Dual incision in TC-NER
Name
Explore in Pharos
Explore in Source
Cytosolic iron-sulfur cluster assembly
DNA Repair
Disease
Dual Incision in GG-NER
Dual incision in TC-NER
Gene Ontology Terms (64)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (304)
1 – 10 of 304
CCNH
Tbio
Novelty: 0.00992686
p_int: 0.992986513
p_ni: 0.007013487
Score: 0.999
Data Source: BioPlex,STRINGDB
CDK7
Tchem
Family: Kinase
Novelty: 0.00400101
p_int: 0.981113795
p_ni: 0.018886205
Score: 0.999
Data Source: BioPlex,STRINGDB
MNAT1
Tbio
Family: Enzyme
Novelty: 0.00719679
p_int: 0.823269031
p_ni: 0.176730969
Score: 0.999
Data Source: BioPlex,STRINGDB
GTF2H3
Tbio
Novelty: 0.1146549
Score: 0.999
Data Source: STRINGDB
GTF2H4
Tbio
Novelty: 0.04141263
Score: 0.999
Data Source: STRINGDB
GTF2H2
Tbio
Novelty: 0.04062705
Score: 0.999
Data Source: STRINGDB
GTF2H1
Tbio
Novelty: 0.02141291
Score: 0.999
Data Source: STRINGDB
ERCC3
Tbio
Family: Enzyme
Novelty: 0.0121836
Score: 0.999
Data Source: STRINGDB
ERCC5
Tchem
Family: Enzyme
Novelty: 0.00918326
Score: 0.999
Data Source: STRINGDB
GTF2H5
Tbio
Novelty: 0.02247624
Score: 0.999
Data Source: STRINGDB
Publication Statistics
PubMed Score  355.45

PubMed score by year
PubTator Score  765.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKL
1-70
IYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTAS
70-140
YVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYH
140-210
YLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQR
210-280
LRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVV
280-350
QESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP
350-420
FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCL
420-490
CPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILEN
490-560
IQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQS
560-630
RILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH
630-700
LTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
700-760
MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL