You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GARS
Glycine--tRNA ligase

Protein Summary
Description
Catalyzes the ligation of glycine to the 3'-end of its cognate tRNA. Also produces diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs. This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000389266
  • ENSP00000373918
  • ENSG00000106105

Symbol
  • HMN5
  • CMT2D
  • DSMAV
  • GlyRS
  • SMAD1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
kinase perturbation
1
interacting protein
0.93
gene perturbation
0.92
protein domain
0.92


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 287.6   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 318   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 287.6   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 318   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (14)
1 – 5 of 14
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Cytosolic tRNA aminoacylation (R-HSA-379716)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytosolic tRNA aminoacylation
Reactome
Metabolism of proteins
Reactome
Mitochondrial tRNA aminoacylation
Reactome
Translation
Reactome
tRNA Aminoacylation
Name
Explore in Pharos
Explore in Source
Cytosolic tRNA aminoacylation
Metabolism of proteins
Mitochondrial tRNA aminoacylation
Translation
tRNA Aminoacylation
Gene Ontology Terms (16)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (195)
1 – 10 of 195
PSMC3
Tbio
Family: Enzyme
Novelty: 0.0502828
p_int: 0.98160331
p_ni: 0.01839669
Score: 0.373
Data Source: BioPlex,STRINGDB
IARS
Tchem
Family: Enzyme
Novelty: 0.0033571
Score: 0.998
Data Source: STRINGDB
EPRS
Tchem
Family: Enzyme
Novelty: 0.00072148
Score: 0.997
Data Source: STRINGDB
AARS
Tbio
Family: Enzyme
Novelty: 0.0027376
Score: 0.994
Data Source: STRINGDB
NARS
Tbio
Family: Enzyme
Novelty: 0.00941326
Score: 0.988
Data Source: STRINGDB
TARSL2
Tbio
Family: Enzyme
Novelty: 0.0300025
Score: 0.988
Data Source: STRINGDB
MARS
Tchem
Family: Enzyme
Novelty: 0.01986188
Score: 0.984
Data Source: STRINGDB
TARS
Tchem
Family: Enzyme
Novelty: 0.0023445
Score: 0.984
Data Source: STRINGDB
SARS
Tbio
Family: Enzyme
Novelty: 0.0040177
Score: 0.983
Data Source: STRINGDB
QARS
Tchem
Family: Enzyme
Novelty: 0.02294313
Score: 0.974
Data Source: STRINGDB
Publication Statistics
PubMed Score  287.60

PubMed score by year
PubTator Score  95.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPSPRPVLLRGARAALLLLLPPRLLARPSLLLRRSLSAASCPPISLPAAASRSSMDGAGAEEVLAPLRLA
1-70
VRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAI
70-140
YGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGE
140-210
CFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNL
210-280
MFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAE
280-350
IEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKV
350-420
GISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPK
420-490
TVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKR
490-560
FQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPF
560-630
VKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEIS
630-700
ELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
700-739
MPSPRPVLLRGARAALLLLLPPRLLARPSLLLRRSLSAASCPPISLPAAASRSSMDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE