You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
DNM2
Dynamin-2

Protein Summary
Description
Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Plays an important role in vesicular trafficking processes, in particular endocytosis. Involved in cytokinesis (PubMed:12498685). Regulates maturation of apoptotic cell corpse-containing phagosomes by recruiting PIK3C3 to the phagosome membrane (By similarity). Dynamins represent one of the subfamilies of GTP-binding proteins. These proteins share considerable sequence similarity over the N-terminal portion of the molecule, which contains the GTPase domain. Dynamins are associated with microtubules. They have been implicated in cell processes such as endocytosis and cell motility, and in alterations of the membrane that accompany certain activities such as bone resorption by osteoclasts. Dynamins bind many proteins that bind actin and other cyt ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000355667
  • ENSP00000347890
  • ENSG00000079805
  • ENST00000359692
  • ENSP00000352721
  • ENST00000389253
  • ENSP00000373905
  • ENST00000408974
  • ENSP00000386192
  • ENST00000585892
  • ENSP00000468734

Symbol
  • DYN2
  • DYN2
  • CMT2M
  • DYNII
  • LCCS5
  • CMTDI1
  • CMTDIB
  • DI-CMTB
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein complex
1
protein domain
1
molecular function
0.98
hub protein
0.94
biological process
0.9


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 306.28   (req: < 5)
Gene RIFs: 106   (req: <= 3)
Antibodies: 213   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 306.28   (req: >= 5)
Gene RIFs: 106   (req: > 3)
Antibodies: 213   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 54
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (46)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 28
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Axon guidance
Reactome
Clathrin-mediated endocytosis
Reactome
Developmental Biology
Reactome
Formation of annular gap junctions
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Axon guidance
Clathrin-mediated endocytosis
Developmental Biology
Formation of annular gap junctions
Gene Ontology Terms (90)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Non-traceable Author Statement (NAS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (334)
1 – 10 of 334
DNM1
Tbio
Novelty: 0.00197543
p_int: 0.999999766
p_ni: 2.34e-7
Score: 0.905
Data Source: BioPlex,STRINGDB
SH3D19
Tbio
Novelty: 0.10852713
p_int: 0.999991744
p_ni: 0.000006584
p_wrong: 0.000001672
Score: 0.399
Data Source: BioPlex,STRINGDB
ACTA1
Tbio
Novelty: 0.00147233
p_int: 0.999949265
p_ni: 0.000050735
Score: 0.447
Data Source: BioPlex,STRINGDB
GRB2
Tchem
Novelty: 0.00060543
p_int: 0.999940946
p_ni: 0.000059054
Score: 0.975
Data Source: BioPlex,STRINGDB
DNMBP
Tbio
Novelty: 0.07594937
p_int: 0.999848614
p_ni: 0.000151222
p_wrong: 1.64e-7
Score: 0.556
Data Source: BioPlex,STRINGDB
DNM3
Tbio
Novelty: 0.03060558
p_int: 0.999702388
p_ni: 0.00029761
p_wrong: 2e-9
Score: 0.982
Data Source: BioPlex,STRINGDB
TMEM9
Tbio
Novelty: 0.1192335
p_int: 0.997667697
p_ni: 0.002332303
Data Source: BioPlex
PCDHGB2
Tdark
p_int: 0.995070269
p_ni: 0.004929242
p_wrong: 4.89e-7
Data Source: BioPlex
TYROBP
Tbio
Family: Enzyme
Novelty: 0.00522854
p_int: 0.990984016
p_ni: 0.009015984
Data Source: BioPlex
IKBIP
Tdark
Family: Enzyme
Novelty: 0.6
p_int: 0.990725941
p_ni: 0.00927221
p_wrong: 0.00000185
Data Source: BioPlex
Publication Statistics
PubMed Score  306.28

PubMed score by year
PubTator Score  280.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLI
1-70
LQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGI
70-140
TKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLM
140-210
DEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKT
210-280
LNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQ
280-350
VDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL
350-420
KEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNH
420-490
EDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKE
490-560
KKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKD
560-630
QAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLY
630-700
SSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRR
700-770
PVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPP
770-840
GIPPGVPSRRPPAAPSRPTIIRPAEPSLLD
840-870
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD