You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
CCDC154
Coiled-coil domain-containing protein 154

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000389176
  • ENSP00000373828
  • ENSG00000197599

Symbol
  • C16orf29
  • C16orf29
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.62
transcription factor
0.57
tissue
0.54
tissue sample
0.53
chemical
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 8   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 8   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (13)
1 – 10 of 13
C2orf81
Tdark
Score: 0.789
Data Source: STRINGDB
STMP1
Tdark
Novelty: 0.71641791
Score: 0.709
Data Source: STRINGDB
ELOA2
Tdark
Family: Enzyme
Novelty: 0.85714286
Score: 0.708
Data Source: STRINGDB
IQCN
Tdark
Novelty: 1
Score: 0.67
Data Source: STRINGDB
JAKMIP3
Tdark
Family: Enzyme
Novelty: 1.42857143
Score: 0.648
Data Source: STRINGDB
MYO3B
Tbio
Family: Kinase
Novelty: 0.14793942
Score: 0.551
Data Source: STRINGDB
PLPP2
Tdark
Family: Enzyme
Novelty: 0.19468126
Score: 0.527
Data Source: STRINGDB
RHBDF1
Tbio
Family: Enzyme
Novelty: 0.0342866
Score: 0.518
Data Source: STRINGDB
NOLC1
Tbio
Novelty: 0.0218027
Score: 0.514
Data Source: STRINGDB
AGAP2
Tbio
Family: Enzyme
Novelty: 0.00181868
Score: 0.492
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.00

PubMed score by year
PubTator Score  1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSELADSGPSGASAPSQLRAVTLEDLGLLLAGGLASPEPLSLEELSERYESSHPTSTASVPEQDTAKHWN
1-70
QLEQWVVELQAEVACLREHKQRCERATRSLLRELLQVRARVQLQGSELRQLQQEARPAAQAPEKEAPEFS
70-140
GLQNQMQALDKRLVEVREALTRLRRRQVQQEAERRGAEQEAGLRLAKLTDLLQQEEQGREVACGALQKNQ
140-210
EDSSRRVDLEVARMQAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGSLRGELE
210-280
SRWEKLRGLMEERLRALQGQHEVGPGGRRAEESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKA
280-350
WDAKGRLEESRAGELAAYVQENLEAAQLAGELARQEMHGELVLLREKSRALEASVAQLAGQLKELSGHLP
350-420
ALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLEDLARWRKEVTEHLRGVREKVDGLPQQIESVSDKCLLH
420-490
KSDSDLRISAEGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLATNQIMKLENCVQANKTI
490-560
QNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMNCWGVYQ
560-630
AVRWLRWKASLIKLRALRRPGGVLEKPHSQEQVQQLTPSLFIQK
630-674
MSELADSGPSGASAPSQLRAVTLEDLGLLLAGGLASPEPLSLEELSERYESSHPTSTASVPEQDTAKHWNQLEQWVVELQAEVACLREHKQRCERATRSLLRELLQVRARVQLQGSELRQLQQEARPAAQAPEKEAPEFSGLQNQMQALDKRLVEVREALTRLRRRQVQQEAERRGAEQEAGLRLAKLTDLLQQEEQGREVACGALQKNQEDSSRRVDLEVARMQAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGSLRGELESRWEKLRGLMEERLRALQGQHEVGPGGRRAEESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKAWDAKGRLEESRAGELAAYVQENLEAAQLAGELARQEMHGELVLLREKSRALEASVAQLAGQLKELSGHLPALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLEDLARWRKEVTEHLRGVREKVDGLPQQIESVSDKCLLHKSDSDLRISAEGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLATNQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMNCWGVYQAVRWLRWKASLIKLRALRRPGGVLEKPHSQEQVQQLTPSLFIQK